DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and rdgC

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster


Alignment Length:276 Identity:94/276 - (34%)
Similarity:147/276 - (53%) Gaps:23/276 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPEAN-YLFLGDYVDRGKQSLETICLLLAYKIK 111
            |:...:...:.:|||:||:..|||.:....|.|..:| |:|.||:|||||:.||.:.|||:..:.
  Fly   229 PVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLA 293

  Fly   112 YSENFFLLRGNHECASINRIYGFYDECKRRY--TIKLWKTFTD-CFNCLPVVAIVDEKIFCCHGG 173
            :....||.|||||.:.:|..|||..|.:.:|  ..|....|.| .:..||:.::::.::...|||
  Fly   294 FPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGG 358

  Fly   174 LSPDLTSMEQIRRIMR---------------PTDVPDQGLLCDLLWSDPDKDTIGWGEND-RGVS 222
            .| |.||::.|:.|.|               |.|..:...:.|::|||| :.|:|...|. ||..
  Fly   359 FS-DSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDP-QATMGCVPNTLRGAG 421

  Fly   223 FTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDNTL 287
            ..||.:|...|||:|.|..:.|:|:...:|:||....:::|:|||.||.....|.||.:.::|.|
  Fly   422 VWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQL 486

  Fly   288 MCSF-QILKPVEKRKK 302
            |..| |.:....:.|:
  Fly   487 MPHFVQYISAASQTKR 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 93/271 (34%)
MPP_PP1_PPKL 6..296 CDD:277359 93/268 (35%)
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 93/266 (35%)
EFh 616..681 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438794
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.