DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and ppp4c

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_988943.1 Gene:ppp4c / 394540 XenbaseID:XB-GENE-970535 Length:307 Species:Xenopus tropicalis


Alignment Length:303 Identity:137/303 - (45%)
Similarity:200/303 - (66%) Gaps:12/303 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEVLNLESIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHG 65
            |.|:.:|:..|.:|....        .:.|.|::.||.|:||||:.:..:..:::|:.:||||||
 Frog     1 MTEISDLDRQIEQLRRCE--------LIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHG 57

  Fly    66 QYYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINR 130
            |:|||..||..||..||.||||:||:||||..|:||..||||.|::|.:...|:|||||...|.:
 Frog    58 QFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQ 122

  Fly   131 IYGFYDECKRRY-TIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVP 194
            :|||||||.|:| ::.:|:..|:.|:.|.:.||:|.||||.||||||.:.:::|||.|.|..:||
 Frog   123 VYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVP 187

  Fly   195 DQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKR 259
            ..|.:||||||||: ||.|||.:.||..:.||::||.:|...:::|:||||||:|.:||::....
 Frog   188 HDGPMCDLLWSDPE-DTTGWGVSPRGAGYLFGSDVVAQFNAANNIDMICRAHQLVMEGYKWHFNE 251

  Fly   260 QLVTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILK--PVEKR 300
            .::|::||||||....|..|::.:|..|...|.|.:  |.|.|
 Frog   252 TVLTVWSAPNYCYRCGNVAAILELDEHLQKEFIIFEAAPQETR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 133/296 (45%)
MPP_PP1_PPKL 6..296 CDD:277359 132/292 (45%)
ppp4cNP_988943.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 132/292 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.