DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and CG11597

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001036602.1 Gene:CG11597 / 39337 FlyBaseID:FBgn0036212 Length:317 Species:Drosophila melanogaster


Alignment Length:281 Identity:121/281 - (43%)
Similarity:174/281 - (61%) Gaps:9/281 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPEANYLFLGDYVDR 94
            |.|:|.||....::|:.:..||.|::|..:|||||||:.|||.|.|.||...|..||||||.|||
  Fly    30 ELEVRQLCRSLSDLLVGESNLLSLQSPQIVCGDIHGQFEDLLHLLELGGSVQEHRYLFLGDLVDR 94

  Fly    95 GKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRY-TIKLWKTFTDCFNCLP 158
            ||.|:||..||.|.|:::.....||||||||.|..|.||||:||..|| :..:|:.....|:.||
  Fly    95 GKNSVETFLLLAALKVRHPAQVSLLRGNHECRSATRSYGFYEECLSRYGSANVWRMCCRVFDLLP 159

  Fly   159 VVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDRGVSF 223
            :.||:|..|.|.|||||||:..::.:|.:.|..::|:.|::.||||||| ::..||..:.||...
  Fly   160 LAAIIDGNILCVHGGLSPDMQRLDDLRSLDRCHEIPESGIIADLLWSDP-QEAPGWAASPRGHGK 223

  Fly   224 TFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDNTLM 288
            .||.:||.:|.:.:.:.|||||||:.:||:.:...:.|||::||||||....|..|::.::....
  Fly   224 LFGGDVVEEFTRANGISLICRAHQLAQDGFRWHFGQLLVTIWSAPNYCYRCGNKAAILRLNAAGD 288

  Fly   289 CSFQIL-------KPVEKRKK 302
            ..|::.       ||..::.|
  Fly   289 YDFKVFEAQALHSKPQPRKPK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 120/276 (43%)
MPP_PP1_PPKL 6..296 CDD:277359 118/273 (43%)
CG11597NP_001036602.1 PTZ00239 12..307 CDD:173488 120/277 (43%)
MPP_superfamily 12..296 CDD:301300 118/266 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438833
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.