DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and PpN58A

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster


Alignment Length:301 Identity:189/301 - (62%)
Similarity:240/301 - (79%) Gaps:4/301 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EVLNLESIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQY 67
            |.:||:.||::|..:  ...|..||:|..||..:|.::||:||.||.|||:.||:.:.|||||||
  Fly    20 EGINLDQIIAKLKLI--GEIGSVVQISVREIEAVCSRAREVLLKQPTLLEIPAPINLLGDIHGQY 82

  Fly    68 YDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIY 132
            .:|||.||..||||::.||.|||||||||||:||:.||||.|.:|...|:||||||||:|||..|
  Fly    83 LNLLRYFESNGYPPDSVYLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFY 147

  Fly   133 GFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQG 197
            |||||||||||:|||:||.||:||||:.||::|.||||||||||.|.||:|||.|.||.::|:.|
  Fly   148 GFYDECKRRYTVKLWRTFVDCYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRRPIEIPESG 212

  Fly   198 LLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLV 262
            |:||:||||||...:|||.|:||||.|||::||..||.:..|:||||.||||||||||||||||:
  Fly   213 LICDILWSDPDLRIMGWGPNERGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQLI 277

  Fly   263 TLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPV--EKRK 301
            |:|||||||||||||||||.::..|:|:|::.:|:  |:|:
  Fly   278 TIFSAPNYCGEFDNAGAMMCINQDLLCTFRVQRPILSEQRR 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 186/295 (63%)
MPP_PP1_PPKL 6..296 CDD:277359 185/289 (64%)
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 185/290 (64%)
MPP_superfamily 23..311 CDD:301300 185/289 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438839
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.