DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and Y71G12B.30

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001021823.2 Gene:Y71G12B.30 / 3565302 WormBaseID:WBGene00044347 Length:333 Species:Caenorhabditis elegans


Alignment Length:307 Identity:144/307 - (46%)
Similarity:194/307 - (63%) Gaps:17/307 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LESIISRLLEVRGARPGKNVQ--LSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYYD 69
            |.::|.||  .:...|| |.|  ..|.||..:|.::||....:|:.||:|||:.||||||||:.|
 Worm    16 LTNVIFRL--TQSWSPG-NCQTLFQEKEIIEICYRAREAFWKEPMKLEIEAPVTICGDIHGQFED 77

  Fly    70 LLRLFEYGGYP------PEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASI 128
            ||.:|:..|:|      ..:.|||||||:|||..|:|.|.||.||::.:.:..||||||||...:
 Worm    78 LLSMFDIYGFPHVSQKDKSSRYLFLGDYIDRGPFSIEVITLLFAYRLLHPQKMFLLRGNHESRPV 142

  Fly   129 NRIYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDV 193
            |..||||:||||||::.|::||...|.|:|:.|||..:|.|.|||:...|.|:|||....||||:
 Worm   143 NMQYGFYNECKRRYSVTLYETFQWAFYCMPLCAIVGGRIMCMHGGIPFGLLSLEQIDEFQRPTDI 207

  Fly   194 PDQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAK 258
            .|.|:..||.|:||....:|:.::.||....||...|.:|.:|..||||.||||||.|||||||.
 Worm   208 ADVGIPSDLCWADPVSGVVGFQDSPRGAGHVFGEATVKEFNEKFKLDLIVRAHQVVMDGYEFFAD 272

  Fly   259 RQLVTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQIL------KPVEK 299
            ::|||:||||.|||.|||.||::.|...:.|:....      .|::|
 Worm   273 KKLVTIFSAPCYCGHFDNLGAVLQVATNMECTINTFGHDLSAAPIKK 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 143/305 (47%)
MPP_PP1_PPKL 6..296 CDD:277359 142/302 (47%)
Y71G12B.30NP_001021823.2 PP2Ac 36..308 CDD:197547 134/271 (49%)
MPP_superfamily 36..304 CDD:301300 133/267 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156380
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.