DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and Pp1-Y2

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster


Alignment Length:299 Identity:218/299 - (72%)
Similarity:258/299 - (86%) Gaps:3/299 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEVLNLESIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHG 65
            :.|:.|::.:|.|:::.|..   |.:.|:|.:||.||.:|||:.::||:||||.||:||||||||
  Fly     8 LTELNNIDQLILRIIDTRRL---KQLNLTETDIRLLCNRSREVFMSQPMLLELSAPVKICGDIHG 69

  Fly    66 QYYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINR 130
            |:.||||||:||||||.:|||||||||||||||:||:||||||||||.|||||||||||.|.|||
  Fly    70 QFTDLLRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPENFFLLRGNHESAGINR 134

  Fly   131 IYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPD 195
            |||||||||||||||||:||.||::|:||.||||||||||||||||||.:|.||.::.||.||||
  Fly   135 IYGFYDECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLLNMNQIGQLARPCDVPD 199

  Fly   196 QGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQ 260
            :||||||||||||...:||.:||||||.||||::|.||:.:|..|||||||||||||||||||||
  Fly   200 KGLLCDLLWSDPDPKIMGWSDNDRGVSVTFGADIVGKFVHRHKFDLICRAHQVVEDGYEFFAKRQ 264

  Fly   261 LVTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVEK 299
            |:|:||||||||||||||||||||.||||||.:|||.:|
  Fly   265 LITIFSAPNYCGEFDNAGAMMSVDETLMCSFYVLKPSKK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 216/293 (74%)
MPP_PP1_PPKL 6..296 CDD:277359 214/289 (74%)
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 217/295 (74%)
MPP_PP1_PPKL 13..300 CDD:277359 214/289 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438738
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.