DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and Pp2B-14D

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster


Alignment Length:308 Identity:123/308 - (39%)
Similarity:178/308 - (57%) Gaps:31/308 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLEVRGARPGK-NVQL------SEGEI-RGLCLK----SREILLAQPILLELEAPLKICGDIHGQ 66
            |.||...|.|| |.:|      .||.| ....||    ...:|..:..::::|||:.:|||||||
  Fly    96 LAEVFDQRTGKPNHELLKQHFILEGRIEEAPALKIIQDGAALLRQEKTMIDIEAPVTVCGDIHGQ 160

  Fly    67 YYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRI 131
            :|||::|||.||.|....|||||||||||..|:|.:..|.:.||.|.:..|||||||||..:...
  Fly   161 FYDLMKLFEVGGSPASTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEY 225

  Fly   132 YGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQ 196
            :.|..|||.:|:.:::....|.|:|||:.|:::::..|.||||||::..:|.|||:.|..:.|..
  Fly   226 FTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAF 290

  Fly   197 GLLCDLLWSDP------DKDTIGWGEND-RGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYE 254
            |.:||||||||      :|::..:..|. ||.|:.:.......|||.::|..|.|||:..:.||.
  Fly   291 GPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYR 355

  Fly   255 FFAKRQ------LVTLFSAPNYCGEFDNAGAMMSVDNTLM------CS 290
            .:.|.|      |:|:||||||...::|..|::..:|.:|      ||
  Fly   356 MYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCS 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 123/308 (40%)
MPP_PP1_PPKL 6..296 CDD:277359 123/308 (40%)
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 117/297 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438848
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.