DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and Ppp1cc

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001257912.1 Gene:Ppp1cc / 24669 RGDID:3377 Length:337 Species:Rattus norvegicus


Alignment Length:303 Identity:276/303 - (91%)
Similarity:288/303 - (95%) Gaps:2/303 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAEV--LNLESIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDI 63
            ||::  ||::|||.|||||||::|||||||.|.||||||||||||.|:|||||||||||||||||
  Rat     1 MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDI 65

  Fly    64 HGQYYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASI 128
            |||||||||||||||:|||:|||||||||||||||||||||||||||||.|||||||||||||||
  Rat    66 HGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASI 130

  Fly   129 NRIYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDV 193
            ||||||||||||||.|||||||||||||||:.||||||||||||||||||.||||||||||||||
  Rat   131 NRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDV 195

  Fly   194 PDQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAK 258
            |||||||||||||||||.:||||||||||||||||||.|||.|||||||||||||||||||||||
  Rat   196 PDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAK 260

  Fly   259 RQLVTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVEKRK 301
            ||||||||||||||||||||||||||.|||||||||||.||:|
  Rat   261 RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 271/293 (92%)
MPP_PP1_PPKL 6..296 CDD:277359 268/289 (93%)
Ppp1ccNP_001257912.1 MPP_PP1_PPKL 8..298 CDD:277359 268/289 (93%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 395 1.000 Domainoid score I733
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X337
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.790

Return to query results.
Submit another query.