DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and Ppef1

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_011246120.1 Gene:Ppef1 / 237178 MGIID:1097157 Length:676 Species:Mus musculus


Alignment Length:364 Identity:107/364 - (29%)
Similarity:161/364 - (44%) Gaps:77/364 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLEVRGARPGKNVQ--LSEGEIRGL--CLKSREILLAQ---PILLELEAPLK------------- 58
            |:||..:..|..:|  |:..:|..|  ..|.::||.|.   .:|.|....||             
Mouse   129 LIEVPDSYDGPRLQFPLTFTDIHILLQAFKQQQILHAHYVLEVLFEARKVLKQMPNFSHVKTFPA 193

  Fly    59 ----ICGDIHGQYYDLLRLFEYGGYPPEAN-YLFLGDYVDRGKQSLETICLLLAYKIKYSENFFL 118
                ||||:||:..||:.:|...|.|.|.| |:|.||:||||..|:|.:.:||...:.|..:..|
Mouse   194 KEITICGDLHGKLDDLMLIFYKNGLPSENNPYVFNGDFVDRGNNSMEILMILLVCFLVYPSDLHL 258

  Fly   119 LRGNHECASINRIYGFYDECKRRYTI---KLWKTFTDCFNCLPVVAIVDEKIFCCHGGL--SPDL 178
            .|||||...:|..|||..|..::|.:   |:.:...:.:..||:..|:|.:|...|||:  |.||
Mouse   259 NRGNHEDFMMNLRYGFTKEILQKYKLHGRKILQVLEEVYTWLPIGTIIDNEILVIHGGISESTDL 323

  Fly   179 TSMEQIR--------------------------------RIMRPTDVPDQGL-------LCDLLW 204
            .::.|::                                |.:.|...|.:.|       :.|:||
Mouse   324 NTLHQLQRNKMKSVLMPPVLGNQETGEKRNKSASNYVEPRKVEPDKTPSEDLTKQEWEQIVDILW 388

  Fly   205 SDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPN 269
            |||......:....||....||.:|..|.|.|:.|.::.|:|:...||||.....:::|:|||.|
Mouse   389 SDPRGKKGCYPNTSRGGGCYFGPDVTSKVLSKNQLKMLIRSHECKPDGYEVSHDGKVITVFSASN 453

  Fly   270 YCGEFDNAGAMMSVDNTLMCSF--------QILKPVEKR 300
            |..|..|.||.:.:....|..|        ..|.|:.:|
Mouse   454 YYEEGSNRGAYIRLSYGTMPQFFQYQVTSTSCLNPLHQR 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 106/361 (29%)
MPP_PP1_PPKL 6..296 CDD:277359 105/358 (29%)
Ppef1XP_011246120.1 MPP_RdgC 144..479 CDD:277364 99/334 (30%)
PTZ00183 518..660 CDD:185503
EF-hand_7 595..663 CDD:372618
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.