DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and Ppp1ca

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_114074.1 Gene:Ppp1ca / 19045 MGIID:103016 Length:330 Species:Mus musculus


Alignment Length:300 Identity:274/300 - (91%)
Similarity:285/300 - (95%) Gaps:0/300 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AEVLNLESIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQ 66
            :|.|||:|||.|||||:|:||||||||:|.||||||||||||.|:||||||||||||||||||||
Mouse     4 SEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQ 68

  Fly    67 YYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRI 131
            ||||||||||||:|||:|||||||||||||||||||||||||||:|.||||||||||||||||||
Mouse    69 YYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRI 133

  Fly   132 YGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQ 196
            |||||||||||.|||||||||||||||:.||||||||||||||||||.|||||||||||||||||
Mouse   134 YGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQ 198

  Fly   197 GLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQL 261
            ||||||||||||||..||||||||||||||||||.|||.||||||||||||||||||||||||||
Mouse   199 GLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQL 263

  Fly   262 VTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVEKRK 301
            |||||||||||||||||||||||.|||||||||||.:|.|
Mouse   264 VTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 271/293 (92%)
MPP_PP1_PPKL 6..296 CDD:277359 268/289 (93%)
Ppp1caNP_114074.1 PTZ00480 6..308 CDD:185658 272/297 (92%)
MPP_PP1_PPKL 8..298 CDD:277359 268/289 (93%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837159
Domainoid 1 1.000 395 1.000 Domainoid score I758
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.720

Return to query results.
Submit another query.