Sequence 1: | NP_524921.1 | Gene: | Pp1-13C / 48531 | FlyBaseID: | FBgn0003132 | Length: | 302 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_030110066.1 | Gene: | Ppef2 / 19023 | MGIID: | 1342304 | Length: | 797 | Species: | Mus musculus |
Alignment Length: | 397 | Identity: | 101/397 - (25%) |
---|---|---|---|
Similarity: | 151/397 - (38%) | Gaps: | 139/397 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 QLSEGEIRGLCLKSREILLAQPILLELEA----PLKICGDIHGQYYDLLRLFEYGGYP-PEANYL 86
Fly 87 FLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYTI---KLWK 148
Fly 149 TFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSME------------------------------- 182
Fly 183 ---------------------------------------------------------QIRR---- 186
Fly 187 -----------------------------------IMRPTDVPDQ-GLLCDLLWSDPDKDTIGWG 215
Fly 216 ENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAM 280
Fly 281 MSVDNTL 287 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pp1-13C | NP_524921.1 | PTZ00480 | 5..299 | CDD:185658 | 101/397 (25%) |
MPP_PP1_PPKL | 6..296 | CDD:277359 | 101/397 (25%) | ||
Ppef2 | XP_030110066.1 | IQ | 61..80 | CDD:197470 | |
MPP_RdgC | 162..581 | CDD:277364 | 101/397 (25%) | ||
FRQ1 | 621..765 | CDD:227455 | |||
EFh | 701..766 | CDD:238008 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0639 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000018 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |