DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and Ppef2

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_030110066.1 Gene:Ppef2 / 19023 MGIID:1342304 Length:797 Species:Mus musculus


Alignment Length:397 Identity:101/397 - (25%)
Similarity:151/397 - (38%) Gaps:139/397 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QLSEGEIRGLCLKSREILLAQPILLELEA----PLKICGDIHGQYYDLLRLFEYGGYP-PEANYL 86
            ||....:..|..::|:.|...|.:..:..    .:.:|||:|||..||:.:|...|.| ||..|:
Mouse   180 QLHARYVLNLLYETRKHLAQLPNINRVSTCYSEEVTVCGDLHGQLDDLIFIFYKNGLPSPERAYV 244

  Fly    87 FLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYTI---KLWK 148
            |.||:|||||.|:|.:.:|.|:.:.|.:.|.|.|||||...:|..|||..|...:|.|   |:.:
Mouse   245 FNGDFVDRGKDSVEVLMVLFAFMLVYPKEFHLNRGNHEDHLVNLRYGFTKEVMHKYKIHGKKILR 309

  Fly   149 TFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSME------------------------------- 182
            |..|.|..||:..:||||:...|||:| |.|.:|                               
Mouse   310 TLQDVFCWLPLATLVDEKVLVLHGGVS-DKTDLELLAKLDRHKIVSTMRCKTRKESENREEQKRK 373

  Fly   183 ---------------------------------------------------------QIRR---- 186
                                                                     |:||    
Mouse   374 DNQTSSGQKPTPWFLPQSRSLPSSPFHLGSGFKAYKAGRSCSIPCGSPNSKELSRRGQVRRSVDL 438

  Fly   187 -----------------------------------IMRPTDVPDQ-GLLCDLLWSDPDKDTIGWG 215
                                               ::.||  |:: ..:.|:|||||........
Mouse   439 ELEQCRQQAGFLGIREKGESLPLAPDADCVADGGGVLEPT--PEEWKQVVDILWSDPAAQEGCKA 501

  Fly   216 ENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAM 280
            ...||....||.:|..:.::|:.|.|:.|:|:...:||||...|:::|:|||.||.....|.||.
Mouse   502 NAVRGGGCYFGPDVTERLMEKYKLQLLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAY 566

  Fly   281 MSVDNTL 287
            :.:...|
Mouse   567 VKLGPAL 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 101/397 (25%)
MPP_PP1_PPKL 6..296 CDD:277359 101/397 (25%)
Ppef2XP_030110066.1 IQ 61..80 CDD:197470
MPP_RdgC 162..581 CDD:277364 101/397 (25%)
FRQ1 621..765 CDD:227455
EFh 701..766 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.