DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and F44B9.9

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001367454.1 Gene:F44B9.9 / 185726 WormBaseID:WBGene00018410 Length:254 Species:Caenorhabditis elegans


Alignment Length:265 Identity:85/265 - (32%)
Similarity:118/265 - (44%) Gaps:74/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EILLAQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPEA-----------NYLFLGDYVDRG 95
            |:...:..|.|:..|:.|.||||||:.||:||.........|           .::|||||||||
 Worm    18 ELFKKEKTLAEISPPVTIVGDIHGQFEDLVRLLNTRNSSENAKSKPIYGFSTKKWVFLGDYVDRG 82

  Fly    96 KQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVV 160
            .:||:.|||:.:.||.:.:.:.|||||||..:||..|||                       .|.
 Worm    83 YKSLDCICLVFSLKICFPKQYILLRGNHETRAINFRYGF-----------------------RVC 124

  Fly   161 AIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDRGVSFTF 225
            ::|..||        |...|.  ||                              .|.||:|..|
 Worm   125 SVVVLKI--------PAKPSF--IR------------------------------NNKRGLSVCF 149

  Fly   226 GAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDNTLMCS 290
            ....|.:..:..::.||.|.||::..|::|||.|:|.|:||||.|..|.||:||:|.|.:....|
 Worm   150 NEAAVNETCRLLNISLIVRGHQMMPAGFKFFADRKLCTIFSAPRYMNEIDNSGAVMKVASNGKIS 214

  Fly   291 FQILK 295
            ..|:|
 Worm   215 ISIMK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 85/265 (32%)
MPP_PP1_PPKL 6..296 CDD:277359 85/265 (32%)
F44B9.9NP_001367454.1 MPP_superfamily 4..219 CDD:417454 84/263 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156435
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.