DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and C47A4.3

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_502650.1 Gene:C47A4.3 / 178340 WormBaseID:WBGene00008124 Length:316 Species:Caenorhabditis elegans


Alignment Length:268 Identity:148/268 - (55%)
Similarity:197/268 - (73%) Gaps:9/268 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ILLAQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPEANYLFLGDYVDRGKQSLETICLLLA 107
            :..||..::|:.||:|:|||||||:.||||||..||:||.|||||||||||||:.|:|||.||||
 Worm    42 VFKAQKPMVEVNAPIKVCGDIHGQFPDLLRLFHRGGWPPTANYLFLGDYVDRGRFSIETIVLLLA 106

  Fly   108 YKIKYSENFFLLRGNHECASINRIYGFYDECKRRY-TIKLWKTFTDCFNCLPVVAIVDEKIFCCH 171
            ||:|:..|||||||||||..:|:.||||:||::|| :::::..|.|.||.||:..::..||.|.|
 Worm   107 YKVKFPCNFFLLRGNHECEFVNKTYGFYEECQKRYQSVRMYAAFQDVFNWLPLTGLIATKILCMH 171

  Fly   172 GGLSPDLT---SMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDRGVSFTFGAEVVVKF 233
            |||||.:|   :::.:|:|.|||: ..:||:.||||:||.....|:..|.||....||.:.|:..
 Worm   172 GGLSPLMTKEFTLDTLRKIERPTE-GKEGLVADLLWADPISGLSGFMNNQRGAGCGFGRDSVLNL 235

  Fly   234 LQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKP-- 296
            ..:..|||:|||||||:|||||||.|:|||:||||:|||:|||..|.||.|..|.|||:||:|  
 Worm   236 CSEFQLDLVCRAHQVVQDGYEFFAGRKLVTIFSAPHYCGQFDNCAAFMSCDEKLQCSFEILRPTT 300

  Fly   297 --VEKRKK 302
              :|.|:|
 Worm   301 GRLEIREK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 145/263 (55%)
MPP_PP1_PPKL 6..296 CDD:277359 144/256 (56%)
C47A4.3NP_502650.1 MPP_superfamily 5..298 CDD:301300 144/256 (56%)
PP2Ac 27..299 CDD:197547 144/257 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156445
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.