DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and ZC477.2

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_501111.2 Gene:ZC477.2 / 177485 WormBaseID:WBGene00022617 Length:374 Species:Caenorhabditis elegans


Alignment Length:313 Identity:102/313 - (32%)
Similarity:165/313 - (52%) Gaps:35/313 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RPGKNVQ-----LSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYYDLLRL------- 73
            :||:.::     ||..|:..:|....:....:..|:|:.||:.:.||:||.::||.|.       
 Worm    40 QPGRVMKRSKNNLSSNEVWSVCRAVIDEFKKEQNLMEVSAPVTVIGDVHGNFHDLYRALLARTEQ 104

  Fly    74 ---------FEYGGYPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASIN 129
                     |....:..: .|:|||:|:|:|.:|:|.||||.|:||.:.:.:.||||.|||.|:|
 Worm   105 DITDEQKSNFSTRQFVRD-KYVFLGNYIDKGPRSIECICLLFAFKICFPQKYILLRGPHECPSVN 168

  Fly   130 --RIYGFYDECKRRYTIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRP-T 191
              ...|..:.....:..|:.|.|.:.|:.:|:.|:|.:||.|.|||:||.|||.|.||:|.|| .
 Worm   169 SSEFLGVMETFSPNHFKKIHKKFNEAFSWMPLAAVVGQKILCVHGGISPRLTSWEDIRKIKRPLK 233

  Fly   192 DVPDQGLLCDLLWSDP-DKDTIGWGEND--------RGVSFTFGAEVVVKFLQKHDLDLICRAHQ 247
            |..:..|..|||::|. |.|.|......        |.:|..:....|.:|.:|.:|.||.|:|.
 Worm   234 DATEDPLATDLLFADTLDFDLIHIPTRKPKYEFNVIRNMSVMYNEAAVTQFCEKFNLKLIIRSHM 298

  Fly   248 VVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDNTLMCSFQILKPVEKR 300
            .|..||.||::::|:|:|::..:..| .|.||::.:|.....:...|.|.:.:
 Worm   299 KVPFGYRFFSEKRLITIFNSTGFQNE-SNYGAVLKIDGNAKITIISLLPQQSK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 102/310 (33%)
MPP_PP1_PPKL 6..296 CDD:277359 101/307 (33%)
ZC477.2NP_501111.2 PP2Ac 52..348 CDD:197547 100/297 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156436
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.