DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and W03D8.2

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001249242.1 Gene:W03D8.2 / 171844 WormBaseID:WBGene00020985 Length:364 Species:Caenorhabditis elegans


Alignment Length:313 Identity:132/313 - (42%)
Similarity:176/313 - (56%) Gaps:37/313 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VQLSEGEIRGLCLKSREILLAQPILLEL-EAPLKICGDIHGQYYDLLRLFEYGGYPPEANYLFLG 89
            |.::..||..|..|.::..|.||.|||: ..|:.:..|:|||...|||:|.....||...|||||
 Worm    45 VDITISEISQLTDKMKKAFLEQPALLEISNEPITVVADMHGQSIHLLRIFLTNEAPPNQKYLFLG 109

  Fly    90 DYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRYT----IKLWKTF 150
            ||||||.||:..:|||...|.:|.::.||||||||..:....|||||||..::.    .|:|:.|
 Worm   110 DYVDRGSQSVVVMCLLFCMKHRYPQHVFLLRGNHEDVNTTLNYGFYDECLEQWKNDEGEKVWRMF 174

  Fly   151 TDCFNCLPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDP-DKDTIGW 214
            .|.|||:|:.|::..|:||.|||:||.|.|:|.|..|.||..||..||.|||||||| ..:..||
 Worm   175 IDTFNCMPLAAVIGGKVFCAHGGISPWLESLEDINSIERPLVVPPYGLACDLLWSDPAQPERNGW 239

  Fly   215 GENDRGVSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYE-----FFAKRQLVTLFSAPNYCGEF 274
            |.:.||:|||:|..||.:|..|:|:.|:.|.||:.::.|.     .|..| |::||||.||.|..
 Worm   240 GLSHRGISFTYGKSVVEEFCAKNDIALVIRGHQLFKEMYPQGCVLRFGGR-LISLFSALNYEGHK 303

  Fly   275 DNA--------GAMMSVDNTL-MC------------SFQILKPV----EKRKK 302
            :|:        |..:.|...| .|            .|:.:|..    |||||
 Worm   304 NNSSVLKLEFVGQRVKVKQVLYRCRHYAPLRSNEYLGFRDMKSSSGKNEKRKK 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 127/308 (41%)
MPP_PP1_PPKL 6..296 CDD:277359 126/301 (42%)
W03D8.2NP_001249242.1 MPP_superfamily 45..306 CDD:301300 120/261 (46%)
PP2Ac 47..312 CDD:197547 120/265 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156398
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.