DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and Ppp6c

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_598273.2 Gene:Ppp6c / 171121 RGDID:708460 Length:305 Species:Rattus norvegicus


Alignment Length:276 Identity:124/276 - (44%)
Similarity:175/276 - (63%) Gaps:15/276 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPEANYLFLGDYV 92
            |.|.:::.||....::||.:..:..:..|:.:|||||||:|||..||..||..|:.||:|:||:|
  Rat    19 LPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFV 83

  Fly    93 DRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRY-TIKLWKTFTDCFNC 156
            |||..||||...|||.|.|:.:...|||||||...|.::|||||||:.:| ....|:..|..|:.
  Rat    84 DRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDM 148

  Fly   157 LPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDP-DKDTIGWGENDRG 220
            |.|.|::||:|.|.|||||||:.:::|||.|.|..::|.:|..|||:|||| |.||  |..:.||
  Rat   149 LTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDT--WAISPRG 211

  Fly   221 VSFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDN 285
            ..:.|||:|..:|:..::|.|||||||:|.:||:|....:|||::||||||....|..::|    
  Rat   212 AGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIM---- 272

  Fly   286 TLMCSFQILKPVEKRK 301
                   :.|.|..|:
  Rat   273 -------VFKDVNTRE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 123/272 (45%)
MPP_PP1_PPKL 6..296 CDD:277359 121/269 (45%)
Ppp6cNP_598273.2 MPP_PP2A_PP4_PP6 5..289 CDD:277360 124/276 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.