DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and ppef1

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_031752607.1 Gene:ppef1 / 100496625 XenbaseID:XB-GENE-6037564 Length:700 Species:Xenopus tropicalis


Alignment Length:380 Identity:100/380 - (26%)
Similarity:156/380 - (41%) Gaps:100/380 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VRGARPGKNVQLSEGEIRGLCLKSREILLAQPILLELEA----PLKICGDIHGQYYDLLRLFEYG 77
            :|..:.|:  ||....:..|..::::.|...|.::.|..    .:.||||:||:..|||.:|...
 Frog   131 LRAFKQGQ--QLHARYVLQLFHETKKFLKQLPNIVHLSTSYSKEITICGDLHGKLDDLLLIFYKN 193

  Fly    78 GYP-PEANYLFLGDYVDRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRR 141
            |.| .|.:|||.||.|||||.|:|.:.||..:.:.|..|..:.|||||...:|..|||.:|..::
 Frog   194 GLPSTENHYLFNGDLVDRGKNSIEILVLLFTFLLMYPNNVHINRGNHEDPIMNLRYGFTNEVIQK 258

  Fly   142 Y---TIKLWKTFTDCFNCLPVVAIVDEKIFCCHGGLSPD-----LTSMEQIR------------- 185
            |   ...:.....|.::.||:..|||.|:...|||:...     |:|:::.:             
 Frog   259 YKGHARNILLLLEDIYSRLPLATIVDSKVLILHGGIGDKTDLDFLSSIDRFKYKSALRTPKTDSE 323

  Fly   186 -----------------------------------------------------------RIMRPT 191
                                                                       ||..|.
 Frog   324 KCTSRDKMLDGKNKKSSVDVGANQNRANKHMTTSSNISQNRSQQGFRSPGILEINYMDSRIQLPD 388

  Fly   192 DVP--------DQGLLCDLLWSDPDKDTIGWGEND-RGVSFTFGAEVVVKFLQKHDLDLICRAHQ 247
            .:|        :...:.|:||||| ::..|...|. ||....||..|..|.|.|::..::.|:|:
 Frog   389 KMPELPDSIRKEWKQVVDILWSDP-RNQNGCTPNSFRGGGCYFGPNVTKKLLAKYNFKMLIRSHE 452

  Fly   248 VVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDNTL---MCSFQILKPVEK 299
            ..::|||.....::||:|||.||..|..|.||.:.:...|   ...:|:.|...|
 Frog   453 CKQEGYELCHNGKVVTIFSASNYYDEGSNRGAYLKLSPDLTPRFVPYQVSKCTRK 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 99/378 (26%)
MPP_PP1_PPKL 6..296 CDD:277359 98/375 (26%)
ppef1XP_031752607.1 MPP_superfamily 121..500 CDD:417454 97/371 (26%)
FRQ1 535..683 CDD:227455
EF-hand_7 616..684 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.