DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp1-13C and ppp4ca

DIOPT Version :9

Sequence 1:NP_524921.1 Gene:Pp1-13C / 48531 FlyBaseID:FBgn0003132 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001103884.1 Gene:ppp4ca / 100003080 ZFINID:ZDB-GENE-030131-4433 Length:311 Species:Danio rerio


Alignment Length:276 Identity:132/276 - (47%)
Similarity:189/276 - (68%) Gaps:4/276 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LSEGEIRGLCLKSREILLAQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPEANYLFLGDYV 92
            :.|.|::.||.|:||||:.:..:..:::|:.:|||||||:|||..||..||..||.||||:||:|
Zfish    24 IKENEVKALCAKAREILVEESNVQSVDSPVTVCGDIHGQFYDLKELFRVGGEVPETNYLFMGDFV 88

  Fly    93 DRGKQSLETICLLLAYKIKYSENFFLLRGNHECASINRIYGFYDECKRRY-TIKLWKTFTDCFNC 156
            |||..|:||..||||.|::|.:...|:|||||...|.::|||:|||.|:| :..:|:..|:.|:.
Zfish    89 DRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFFDECHRKYGSATVWRYCTEIFDY 153

  Fly   157 LPVVAIVDEKIFCCHGGLSPDLTSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTIGWGENDRGV 221
            |.:.||||.||||.||||||.:.:::|||.|.|..:||..|.:||||||||: ||.|||.:.||.
Zfish   154 LSLSAIVDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPE-DTTGWGVSPRGA 217

  Fly   222 SFTFGAEVVVKFLQKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDNT 286
            .:.||::||.:|...:|:.:||||||:|.:||::.....::|::||||||....|..|::.:|..
Zfish   218 GYLFGSDVVAQFNAANDISMICRAHQLVMEGYKWHFNDTVLTVWSAPNYCYRCGNVAAILELDEH 282

  Fly   287 LMCSFQILK--PVEKR 300
            |...|.|.:  |.|.|
Zfish   283 LQKEFIIFEAAPQETR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp1-13CNP_524921.1 PTZ00480 5..299 CDD:185658 130/273 (48%)
MPP_PP1_PPKL 6..296 CDD:277359 129/270 (48%)
ppp4caNP_001103884.1 PTZ00239 10..311 CDD:173488 132/276 (48%)
MPP_PP2A_PP4_PP6 10..294 CDD:277360 129/270 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.