DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grip91 and AT3G43610

DIOPT Version :9

Sequence 1:NP_524919.2 Gene:Grip91 / 48481 FlyBaseID:FBgn0001612 Length:917 Species:Drosophila melanogaster
Sequence 2:NP_001325537.1 Gene:AT3G43610 / 823458 AraportID:AT3G43610 Length:1208 Species:Arabidopsis thaliana


Alignment Length:338 Identity:72/338 - (21%)
Similarity:140/338 - (41%) Gaps:70/338 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   532 YQQTSKHVLDIMVGPHKLLDHLHGMRRYLLLGQGDFISILIENM-KNELERPGLDIYANDLTSML 595
            |...||..:.::.....|.:||..:|||..:...|:..:.:.:: .::......|....::...|
plant   862 YNFVSKLAIKLLEEGFGLQEHLLALRRYHFMELADWADVFVVSLWHHKWLVTEADKRIAEIQGFL 926

  Fly   596 DSALRCTNAQYD---DPDILNHLDVIVQRPFN--GDIGWNIISLQYIVHGPLAAMLE-STMPTYK 654
            :|:::.::.:.|   |...|......:..|.:  |...::.:.|.|.|..|::.:|. ..:..|.
plant   927 ESSIQRSSCERDICKDRIFLYKRQGTMHIPPSTIGVRSFDFLRLGYRVDWPISIILTCDALTAYA 991

  Fly   655 VLFKPLWRMKHMEFVLSMKIW-----KEQMGNAKALRTMKSEIG------KASHRLNLFTSEIMH 708
            .:|..|.::|...:||: .:|     ...|.:.|..:.:|.|:.      |..|::|       |
plant   992 DVFSFLVQVKLAAYVLT-DVWCSLKDVRHMMHEKKEKILKQELRWLNILMKLRHQVN-------H 1048

  Fly   709 FIHQMQYYVLFEVIECNWVE----LQKKMQKATTLDEILEAHEKFL-QTILVGCFVSNKASVEHS 768
            |:..:|.||..|:...:|.:    |:.|::....|:.:   |..:| :.:.:.||:|::..:   
plant  1049 FVTALQQYVHSELSHVSWSKFLHSLKNKVKDMMDLESV---HMAYLSEALRIRCFLSDETQI--- 1107

  Fly   769 LEVVYENIIEL--------------------EKW---------QSSFYKDCF-KELNARKELSKI 803
            :..:.|||::.                    :.|         |....|..| |||   |||.|.
plant  1108 ISNIIENILQCALDFRSCLPRGIQSTDRVPNDSWTKTLGINTSQVMMVKQNFDKEL---KELHKC 1169

  Fly   804 VEKSEKKGVYGLT 816
            ..:|.|.|.|||:
plant  1170 HLRSPKHGKYGLS 1182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grip91NP_524919.2 Spc97_Spc98 236..758 CDD:282045 49/248 (20%)
AT3G43610NP_001325537.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2000
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.