DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dip-B and NPEPL1

DIOPT Version :9

Sequence 1:NP_001287316.1 Gene:Dip-B / 48450 FlyBaseID:FBgn0000454 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_078939.3 Gene:NPEPL1 / 79716 HGNCID:16244 Length:523 Species:Homo sapiens


Alignment Length:449 Identity:116/449 - (25%)
Similarity:183/449 - (40%) Gaps:83/449 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 RSMEKVLKAGFHTPLLFVPKVKRFPEV--ELCTVLGALEQLYVPIQLREAGTLKDPRVTTLSVQI 152
            |.:...|..|.|..::.|.:.   |||  ..|.:..|.     |:....:|..:.....|::|:.
Human    97 RLVRTCLPPGAHRCIVMVCEQ---PEVFASACALARAF-----PLFTHRSGASRRLEKKTVTVEF 153

  Fly   153 -----DDPRAEAIFQEAL--ILEAGRFVARDIGVGDPERMTPIQVEKYIKPLFDKLNV--NVISD 208
                 |:...|....:.|  ..:..|..||.:.....|..|...:|: |..:..:|.:  .:|.|
Human   154 FLVGQDNGPVEVSTLQCLANATDGVRLAARIVDTPCNEMNTDTFLEE-INKVGKELGIIPTIIRD 217

  Fly   209 TQVLQKEYPLFAAVNRAADAVERHRGRIIFLEYKPPKPARKTLMLVGKGVTYDTGGADIKAGGVM 273
            .::..:.:.....|.:||    .|...:..|.: .|..|.:|:..||||:.|||||..||....|
Human   218 EELKTRGFGGIYGVGKAA----LHPPALAVLSH-TPDGATQTIAWVGKGIVYDTGGLSIKGKTTM 277

  Fly   274 AGMSRDKCGAAAVAG-FMQVVSQLQPDDIHVVAALCMVRNSVGEECYVADEVITSRAGLHVRIGN 337
            .||.||..|||||.| |...:.|...|::|  |..|:..||||......|::....:|..|.|.|
Human   278 PGMKRDCGGAAAVLGAFRAAIKQGFKDNLH--AVFCLAENSVGPNATRPDDIHLLYSGKTVEINN 340

  Fly   338 TDAEGRMCMTDAL---CRMKELVVEQNLPDPHLFTIATLTGHAFISAGEGQSIAIDNSVAHREDH 399
            ||||||:.:.|.:   |:        :|....:..:|||||...|:.|:..:..:.||.   |..
Human   341 TDAEGRLVLADGVSYACK--------DLGADIILDMATLTGAQGIATGKYHAAVLTNSA---EWE 394

  Fly   400 ARRLQAAGQAFGEPFEVSILRP----SDFSFNAGKVIGEDLVQANNAPSVRTPRGHQVPAAFMIK 460
            |..:: ||:..|:.....:..|    |:|: :|...:...:...:|:||       .....|:..
Human   395 AACVK-AGRKCGDLVHPLVYCPELHFSEFT-SAVADMKNSVADRDNSPS-------SCAGLFIAS 450

  Fly   461 ASGLDKHGLDSMLPIKYTHIDIA---------------------GSAGEHPAMPTAAPL 498
            ..|.|..|:       :.|:|||                     |.|.|.|.:...:||
Human   451 HIGFDWPGV-------WVHLDIAAPVHAGERATGFGVALLLALFGRASEDPLLNLVSPL 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dip-BNP_001287316.1 Peptidase_M17 58..502 CDD:238247 116/449 (26%)
NPEPL1NP_078939.3 Peptidase_M17 35..487 CDD:238247 110/432 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D562530at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1683
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.