powered by:
Protein Alignment Dip-B and CG32061
DIOPT Version :9
Sequence 1: | NP_001287316.1 |
Gene: | Dip-B / 48450 |
FlyBaseID: | FBgn0000454 |
Length: | 508 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_729611.1 |
Gene: | CG32061 / 39196 |
FlyBaseID: | FBgn0052061 |
Length: | 214 |
Species: | Drosophila melanogaster |
Alignment Length: | 44 |
Identity: | 13/44 - (29%) |
Similarity: | 18/44 - (40%) |
Gaps: | 1/44 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 463 GLDKHGLDSMLPIKYTHIDIAGSAGEHPAMPTAAPLVSLVKTHL 506
||..|...|:..|.|....|.|......|...:...:| ::|||
Fly 170 GLFWHRSTSVTLIPYWSQIIGGGVSLEKASHLSGNCIS-IETHL 212
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Dip-B | NP_001287316.1 |
Peptidase_M17 |
58..502 |
CDD:238247 |
10/38 (26%) |
CG32061 | NP_729611.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0260 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.