DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dip-B and S-Lap7

DIOPT Version :9

Sequence 1:NP_001287316.1 Gene:Dip-B / 48450 FlyBaseID:FBgn0000454 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001260959.1 Gene:S-Lap7 / 36524 FlyBaseID:FBgn0033868 Length:527 Species:Drosophila melanogaster


Alignment Length:289 Identity:64/289 - (22%)
Similarity:113/289 - (39%) Gaps:59/289 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 IIFLEYKPPKPARKTLMLVGKGVTYDTGGADIKAGGVMAGMSRDKCGAAAVAGFMQVVSQLQ-PD 299
            ::.|.|....|..|.::.||||:|:::|..:::....|.........||.....|:.::.|. |.
  Fly   266 LLELSYCGTAPDDKPILFVGKGITFNSGALNLRPCRGMDEYRGSMSAAACCVAMMRCIAALSLPI 330

  Fly   300 DIHVVAALCMVRNSVGEECYVADEVITSRAGLHVRIGNTDAEGRMCMTDAL-----CRMKELVVE 359
            ::..:..||  .|..........:|:|...|..:.|.:.|..|.:.::|.|     ..:..|||:
  Fly   331 NVTCIIPLC--ENMPSGMSAKPGDVVTLLNGKSMAIRDLDKAGVVVLSDPLLYGQKTYLPRLVVD 393

  Fly   360 QNLPDPHLFTIATLTGHAFISAGEGQSIAIDNSVAHREDHA--RRLQAAGQAFGEPFEVSILRPS 422
                      ||||......:.|.|.:....||      |.  ::.|.||...|:    .:.|..
  Fly   394 ----------IATLNTGVKKAFGGGATGIWSNS------HYIWKQFQRAGSISGD----RVWRLP 438

  Fly   423 DFSFNAGKVIGE---DLVQANNAPSVRTPRGHQVPAAFMIKASGLDKHGLDSMLP-IKYTHIDIA 483
            .:.:...:|..|   ||  :||.      ||        :.:|.|....|..::| :.:.|:|..
  Fly   439 LWQYYRRQVTDERAYDL--SNNG------RG--------LASSCLAAAILHELVPCVDWAHLDTR 487

  Fly   484 GSA--GEHPAMP-------TAAPLVSLVK 503
            |:.  .::..:|       |..|..:||:
  Fly   488 GTGLLSKYGLVPYLTKKRMTGRPTRTLVQ 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dip-BNP_001287316.1 Peptidase_M17 58..502 CDD:238247 62/286 (22%)
S-Lap7NP_001260959.1 PRK00913 36..518 CDD:234863 64/289 (22%)
Peptidase_M17 39..518 CDD:238247 64/289 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472713
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D562530at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11963
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.