DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dip-B and S-Lap4

DIOPT Version :9

Sequence 1:NP_001287316.1 Gene:Dip-B / 48450 FlyBaseID:FBgn0000454 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_729613.1 Gene:S-Lap4 / 326188 FlyBaseID:FBgn0052064 Length:524 Species:Drosophila melanogaster


Alignment Length:178 Identity:45/178 - (25%)
Similarity:75/178 - (42%) Gaps:18/178 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 LEYKPPKPARKTLMLVGKGVTYDTGGADIKAGGVMAGMSRDKCGAAAVAGFMQVVSQLQ-PDDIH 302
            :.|....|..|.::.:|||:|:::|..:::....|........|||:....|:.|:.|. |.::.
  Fly   265 ITYCGTNPEDKPILFLGKGITFNSGAMNLRKCRGMEEYRACMSGAASCVAMMRCVAALALPINVC 329

  Fly   303 VVAALCMVRNSVGEECYVADEVITSRAGLHVRIGNTDAEGRMCMTDALCRMKELVVEQNLPDPHL 367
            .:..||....| |..|...| |:|......:.:.|.|..|.:.|.|      .|:..|:...|.|
  Fly   330 CIIPLCENMPS-GMACKPGD-VVTLMNHKSMAVRNLDKAGVVVMAD------PLLYGQSTYKPRL 386

  Fly   368 FT-IATLTGHAFISAGEGQSIAIDNSVAHREDHA--RRLQAAGQAFGE 412
            .. :|||......:.|.|.:....||      |.  ::.|:||...|:
  Fly   387 VVDVATLGSGVKKAFGGGATGIFSNS------HYIWKQFQSAGALTGD 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dip-BNP_001287316.1 Peptidase_M17 58..502 CDD:238247 45/178 (25%)
S-Lap4NP_729613.1 PRK00913 31..514 CDD:234863 45/178 (25%)
Peptidase_M17 35..514 CDD:238247 45/178 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472712
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D562530at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11963
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.