DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dip-B and S-Lap3

DIOPT Version :9

Sequence 1:NP_001287316.1 Gene:Dip-B / 48450 FlyBaseID:FBgn0000454 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_001261679.1 Gene:S-Lap3 / 326187 FlyBaseID:FBgn0045770 Length:535 Species:Drosophila melanogaster


Alignment Length:208 Identity:49/208 - (23%)
Similarity:84/208 - (40%) Gaps:51/208 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 GDPERMTPIQVEKYIKPLF--DKLNV---------NVISDTQVLQKEYPLFAAVN---------- 223
            |.|:      ||.:.:.||  :..|:         |.::.|.|.|      |||:          
  Fly   193 GSPD------VESWTRGLFKAEAQNLARRLCDAPANCMTPTIVAQ------AAVDSLCPCGITVE 245

  Fly   224 -RAADAVE-RHRGRIIFL---EYKPP----------KPARKTLMLVGKGVTYDTGGADIKAGGVM 273
             |..:.:| :|....:.:   ..:||          .|..|.::|||:|:|:::||.:::....|
  Fly   246 VRTMEWIEQQHLNSFLMIAKGSCEPPVLLEVAYCGTAPEDKPILLVGQGITFNSGGINLRPCKGM 310

  Fly   274 AGMSRDKCGAAAVAGFMQVVSQLQ-PDDIHVVAALCMVRNSVGEECYVADEVITSRAGLHVRIGN 337
            .....|..|||.:...|:..:.|. |.:|..|..||....| |..|...| |:|......:.:.|
  Fly   311 DEFRGDLTGAACILAAMRAAAALSLPINITAVIPLCENLPS-GMSCKPGD-VVTLLNSKSLAVRN 373

  Fly   338 TDAEGRMCMTDAL 350
            ....|.:.::|.:
  Fly   374 ISRTGVVVISDPM 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dip-BNP_001287316.1 Peptidase_M17 58..502 CDD:238247 49/208 (24%)
S-Lap3NP_001261679.1 Peptidase_M17 47..525 CDD:238247 49/208 (24%)
PRK00913 49..525 CDD:234863 49/208 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472708
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D562530at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11963
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1683
SonicParanoid 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.