DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dip-B and Npepl1

DIOPT Version :9

Sequence 1:NP_001287316.1 Gene:Dip-B / 48450 FlyBaseID:FBgn0000454 Length:508 Species:Drosophila melanogaster
Sequence 2:XP_006235750.1 Gene:Npepl1 / 311671 RGDID:1311351 Length:524 Species:Rattus norvegicus


Alignment Length:451 Identity:120/451 - (26%)
Similarity:185/451 - (41%) Gaps:87/451 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 RSMEKVLKAGFHTPLLFVPKVKRFPEV--ELCTVLGALEQLYVPIQLREAGTLKDPRVTTLSVQI 152
            |.:...|..|.|..:|.|.:.   |||  ..|.:..|.     |:....:|..:.....|:.|:.
  Rat    97 RLVRTCLPPGTHRCILMVCEQ---PEVFASACALARAF-----PLFTHRSGASRRTEKRTVMVEF 153

  Fly   153 -----DDPRAEAIFQEAL--ILEAGRFVARDIGVGDPERMTPIQVEKYIKPLFDKLNV--NVISD 208
                 |:...|....:.|  ..|..|..||.:.....|..|.|.:|: |..:..:|.:  .:|.|
  Rat   154 FLVGQDNGPVEVSTLQCLTNATEGVRLAARIVDTPCSEMNTDIFLEE-ISQVGRELGITPTIIRD 217

  Fly   209 TQVLQKEYPLFAAVNRAADAVERHRGRIIFLEYKPPKPARKTLMLVGKGVTYDTGGADIKAGGVM 273
            .|:..|.:.....|.:||    .|...:..|.: .|..|.:|:..||||:.|||||..||....|
  Rat   218 EQLKTKGFGGIYGVGKAA----LHPPALAVLSH-TPDGATQTIAWVGKGIVYDTGGLSIKGKTTM 277

  Fly   274 AGMSRDKCGAAAVAG-FMQVVSQLQPDDIHVVAALCMVRNSVGEECYVADEVITSRAGLHVRIGN 337
            .||.||..||||:.| |...:.|...|::|  |..|:..|:||......|::....:|..|.|.|
  Rat   278 PGMKRDCGGAAAILGAFRAAIKQGFKDNLH--AVFCLAENAVGPNATRPDDIHLLYSGKTVEINN 340

  Fly   338 TDAEGRMCMTDAL---CR--MKELVVEQNLPDPHLFTIATLTGHAFISAGEGQSIAIDNSVAHRE 397
            ||||||:.:.|.:   |:  ..:::|:          :|||||...|:.|:..:..:.||.   |
  Rat   341 TDAEGRLVLADGVSYACKDLGADIIVD----------MATLTGAQGIATGKYHAAVLTNSA---E 392

  Fly   398 DHARRLQAAGQAFGEPFEVSILRP----SDFSFNAGKVIGEDLVQANNAPSVRTPRGHQVPAAFM 458
            ..|..:: |||..|:.....:..|    |:|: :|...:...:...:|:||       .....|:
  Rat   393 WEAACVK-AGQKCGDLVHPLVYCPELHFSEFT-SAVADMKNSVADRDNSPS-------SCAGLFI 448

  Fly   459 IKASGLDKHGLDSMLPIKYTHIDIA---------------------GSAGEHPAMPTAAPL 498
            ....|.|..|:       :.|:|||                     |.|.|.|.:...:||
  Rat   449 ASHIGFDWPGV-------WVHLDIAAPVHAGERATGFGVALLLALFGRASEDPLLNLVSPL 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dip-BNP_001287316.1 Peptidase_M17 58..502 CDD:238247 120/451 (27%)
Npepl1XP_006235750.1 Peptidase_M17 35..487 CDD:238247 114/434 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D562530at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.