DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIalpha and CKA1

DIOPT Version :9

Sequence 1:NP_001036624.1 Gene:CkIIalpha / 48448 FlyBaseID:FBgn0264492 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_201539.2 Gene:CKA1 / 836873 AraportID:AT5G67380 Length:409 Species:Arabidopsis thaliana


Alignment Length:321 Identity:243/321 - (75%)
Similarity:284/321 - (88%) Gaps:0/321 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SAARVYTDVNAHKPDEYWDYENYVVDWGNQDDYQLVRKLGRGKYSEVFEAINITTTEKCVVKILK 69
            |.|||||:||..:|.:|||||:.:|.||.||||::|||:||||||||||.||:.:.|||::||||
plant    78 SKARVYTEVNVIRPKDYWDYESLIVQWGEQDDYEVVRKVGRGKYSEVFEGINVNSKEKCIIKILK 142

  Fly    70 PVKKKKIKREIKILENLRGGTNIITLLAVVKDPVSRTPALIFEHVNNTDFKQLYQTLTDYEIRYY 134
            |||||||:||||||:||.||.||:.||.||:|..|:||:||||:||:||||.||.|||||:||||
plant   143 PVKKKKIRREIKILQNLCGGPNIVKLLDVVRDQHSKTPSLIFEYVNSTDFKVLYPTLTDYDIRYY 207

  Fly   135 LFELLKALDYCHSMGIMHRDVKPHNVMIDHENRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPE 199
            ::|||||||:|||.|||||||||||||||||.|||||||||||||||||:|||||||||||||||
plant   208 IYELLKALDFCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPE 272

  Fly   200 LLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEELYAYLDKYNIDLD 264
            ||||.|.|||||||||||||.|.|||||||||:||||.||||:|||||||:||.|||:||.::||
plant   273 LLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNQDQLVKIAKVLGTDELNAYLNKYQLELD 337

  Fly   265 PRFHDILQRHSRKRWERFVHSDNQHLVSPEALDFLDKLLRYDHVDRLTAREAMAHPYFLPI 325
            |:...::.|||||.|.:|:::||||||||||:|||||||||||.|||||:|||||.||..:
plant   338 PQLEALVGRHSRKPWSKFINADNQHLVSPEAIDFLDKLLRYDHQDRLTAKEAMAHAYFAQV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIIalphaNP_001036624.1 STKc_CK2_alpha 18..322 CDD:271034 233/303 (77%)
CKA1NP_201539.2 STKc_CK2_alpha 91..395 CDD:271034 233/303 (77%)
Pkinase 110..395 CDD:278497 221/284 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 475 1.000 Domainoid score I87
eggNOG 1 0.900 - - E1_KOG0668
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 527 1.000 Inparanoid score I285
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1098380at2759
OrthoFinder 1 1.000 - - FOG0000968
OrthoInspector 1 1.000 - - otm2509
orthoMCL 1 0.900 - - OOG6_100821
Panther 1 1.100 - - O PTHR24054
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X569
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.