DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIalpha and CKA3

DIOPT Version :9

Sequence 1:NP_001036624.1 Gene:CkIIalpha / 48448 FlyBaseID:FBgn0264492 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_179890.1 Gene:CKA3 / 816838 AraportID:AT2G23080 Length:333 Species:Arabidopsis thaliana


Alignment Length:321 Identity:240/321 - (74%)
Similarity:278/321 - (86%) Gaps:0/321 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SAARVYTDVNAHKPDEYWDYENYVVDWGNQDDYQLVRKLGRGKYSEVFEAINITTTEKCVVKILK 69
            |.||||||||..:|.||||||:.||.||:||||::|||:||||||||||..|:.|.|:||:||||
plant     2 SKARVYTDVNVVRPKEYWDYESLVVQWGHQDDYEVVRKVGRGKYSEVFEGKNVNTNERCVIKILK 66

  Fly    70 PVKKKKIKREIKILENLRGGTNIITLLAVVKDPVSRTPALIFEHVNNTDFKQLYQTLTDYEIRYY 134
            ||||||||||||||:||.||.||:.|..:|:|..|:||:|:||.||:.|||.||.|||||:||||
plant    67 PVKKKKIKREIKILQNLCGGPNIVKLYDIVRDEHSKTPSLVFEFVNSVDFKVLYPTLTDYDIRYY 131

  Fly   135 LFELLKALDYCHSMGIMHRDVKPHNVMIDHENRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPE 199
            ::|||||||:|||.||||||||||||||||:.|||||||||||||||||:|||||||||||||||
plant   132 IYELLKALDFCHSQGIMHRDVKPHNVMIDHQLRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPE 196

  Fly   200 LLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEELYAYLDKYNIDLD 264
            ||||.|.|||||||||||||.|.|||||||||:||||:||||:|||||||.||..||:||.:|||
plant   197 LLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTNELDHYLNKYQLDLD 261

  Fly   265 PRFHDILQRHSRKRWERFVHSDNQHLVSPEALDFLDKLLRYDHVDRLTAREAMAHPYFLPI 325
            |:...::.||..|.|.:|:::||||||||||:|||||||:|||.|||||||||.||||..:
plant   262 PQLEALVGRHVPKPWSKFINADNQHLVSPEAIDFLDKLLQYDHQDRLTAREAMDHPYFAQV 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIIalphaNP_001036624.1 STKc_CK2_alpha 18..322 CDD:271034 229/303 (76%)
CKA3NP_179890.1 STKc_CK2_alpha 15..319 CDD:271034 229/303 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 475 1.000 Domainoid score I87
eggNOG 1 0.900 - - E1_KOG0668
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 527 1.000 Inparanoid score I285
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1098380at2759
OrthoFinder 1 1.000 - - FOG0000968
OrthoInspector 1 1.000 - - otm2509
orthoMCL 1 0.900 - - OOG6_100821
Panther 1 1.100 - - O PTHR24054
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X569
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.