DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIalpha and csnk2a2

DIOPT Version :9

Sequence 1:NP_001036624.1 Gene:CkIIalpha / 48448 FlyBaseID:FBgn0264492 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001008080.1 Gene:csnk2a2 / 493442 XenbaseID:XB-GENE-487069 Length:110 Species:Xenopus tropicalis


Alignment Length:99 Identity:78/99 - (78%)
Similarity:86/99 - (86%) Gaps:0/99 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SAARVYTDVNAHKPDEYWDYENYVVDWGNQDDYQLVRKLGRGKYSEVFEAINITTTEKCVVKILK 69
            |.||||.|||:.:..||||||.:|.:||||:|||||||||||||||||||||||..|:.||||||
 Frog     8 SKARVYADVNSLRSREYWDYEAHVPNWGNQEDYQLVRKLGRGKYSEVFEAINITNNERVVVKILK 72

  Fly    70 PVKKKKIKREIKILENLRGGTNIITLLAVVKDPV 103
            ||||||||||:|||||||||||||.||..:||||
 Frog    73 PVKKKKIKREVKILENLRGGTNIIRLLDTIKDPV 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIIalphaNP_001036624.1 STKc_CK2_alpha 18..322 CDD:271034 70/86 (81%)
csnk2a2NP_001008080.1 PKc_like 22..>106 CDD:328722 68/83 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000968
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X569
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.