DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIalpha and Csnk2a2

DIOPT Version :9

Sequence 1:NP_001036624.1 Gene:CkIIalpha / 48448 FlyBaseID:FBgn0264492 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001100879.1 Gene:Csnk2a2 / 307641 RGDID:1306882 Length:350 Species:Rattus norvegicus


Alignment Length:328 Identity:267/328 - (81%)
Similarity:296/328 - (90%) Gaps:0/328 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SAARVYTDVNAHKPDEYWDYENYVVDWGNQDDYQLVRKLGRGKYSEVFEAINITTTEKCVVKILK 69
            |.||||::||:.:..||||||.:|..||||||||||||||||||||||||||||..|:.||||||
  Rat     8 SRARVYSEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILK 72

  Fly    70 PVKKKKIKREIKILENLRGGTNIITLLAVVKDPVSRTPALIFEHVNNTDFKQLYQTLTDYEIRYY 134
            ||||||||||:|||||||||||||.|:..||||||:||||:||::||||||||||.|||::||:|
  Rat    73 PVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFY 137

  Fly   135 LFELLKALDYCHSMGIMHRDVKPHNVMIDHENRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPE 199
            ::|||||||||||.||||||||||||||||:.:|||||||||||||||.||||||||||||||||
  Rat   138 MYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPE 202

  Fly   200 LLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEELYAYLDKYNIDLD 264
            ||||||||||||||||||||||||||||||||||.|||||||||||||||::||.||.||:||||
  Rat   203 LLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGQDNYDQLVRIAKVLGTDDLYGYLKKYHIDLD 267

  Fly   265 PRFHDILQRHSRKRWERFVHSDNQHLVSPEALDFLDKLLRYDHVDRLTAREAMAHPYFLPIVNGQ 329
            |.|:|||.:|||||||.|:||:|:|||||||||.|||||||||..||||:|||.||||.|:|..|
  Rat   268 PHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQ 332

  Fly   330 MNP 332
            ..|
  Rat   333 SQP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIIalphaNP_001036624.1 STKc_CK2_alpha 18..322 CDD:271034 254/303 (84%)
Csnk2a2NP_001100879.1 STKc_CK2_alpha 22..326 CDD:271034 255/303 (84%)
Pkinase 40..325 CDD:278497 241/284 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335044
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0668
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1098380at2759
OrthoFinder 1 1.000 - - FOG0000968
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100821
Panther 1 1.100 - - O PTHR24054
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X569
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.710

Return to query results.
Submit another query.