DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIalpha and csnk2a2a

DIOPT Version :9

Sequence 1:NP_001036624.1 Gene:CkIIalpha / 48448 FlyBaseID:FBgn0264492 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_571315.1 Gene:csnk2a2a / 30488 ZFINID:ZDB-GENE-990415-28 Length:348 Species:Danio rerio


Alignment Length:331 Identity:261/331 - (78%)
Similarity:290/331 - (87%) Gaps:0/331 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SAARVYTDVNAHKPDEYWDYENYVVDWGNQDDYQLVRKLGRGKYSEVFEAINITTTEKCVVKILK 69
            |.||||.|.|..|..||||||.:|..|.|||||||||||||||||||||||||.:.::.||||||
Zfish     7 SKARVYADANTVKSKEYWDYEAHVPSWSNQDDYQLVRKLGRGKYSEVFEAININSNDRVVVKILK 71

  Fly    70 PVKKKKIKREIKILENLRGGTNIITLLAVVKDPVSRTPALIFEHVNNTDFKQLYQTLTDYEIRYY 134
            ||||||||||||||||||||||||.|:..|||||||||||:||::||||||.|||.|||::||:|
Zfish    72 PVKKKKIKREIKILENLRGGTNIIRLVDTVKDPVSRTPALVFEYINNTDFKDLYQRLTDFDIRFY 136

  Fly   135 LFELLKALDYCHSMGIMHRDVKPHNVMIDHENRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPE 199
            |:||||||||.|||||||||||||||||||:.||||||||||||||||.||||||||||.:||||
Zfish   137 LYELLKALDYSHSMGIMHRDVKPHNVMIDHQMRKLRLIDWGLAEFYHPAQEYNVRVASRSYKGPE 201

  Fly   200 LLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEELYAYLDKYNIDLD 264
            ||||||||||||||||||||||||||:|||||||.|||||||||||||||||.::||:||:|:||
Zfish   202 LLVDYQMYDYSLDMWSLGCMLASMIFQKEPFFHGQDNYDQLVRIAKVLGTEEQFSYLNKYHIELD 266

  Fly   265 PRFHDILQRHSRKRWERFVHSDNQHLVSPEALDFLDKLLRYDHVDRLTAREAMAHPYFLPIVNGQ 329
            .||.|:|.:.:|||||.||..:|||||||||||.|||||||||..||||:|||.||||.|::.||
Zfish   267 TRFKDLLGQQTRKRWENFVLPENQHLVSPEALDLLDKLLRYDHQQRLTAQEAMEHPYFYPVLKGQ 331

  Fly   330 MNPNNQ 335
            ...|::
Zfish   332 PLSNSE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIIalphaNP_001036624.1 STKc_CK2_alpha 18..322 CDD:271034 247/303 (82%)
csnk2a2aNP_571315.1 STKc_CK2_alpha 21..325 CDD:271034 248/303 (82%)
Pkinase 39..324 CDD:278497 235/284 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574296
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0668
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1098380at2759
OrthoFinder 1 1.000 - - FOG0000968
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24054
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X569
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.