DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acph-1 and MINPP1

DIOPT Version :9

Sequence 1:NP_733332.1 Gene:Acph-1 / 48445 FlyBaseID:FBgn0000032 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_004888.2 Gene:MINPP1 / 9562 HGNCID:7102 Length:487 Species:Homo sapiens


Alignment Length:453 Identity:83/453 - (18%)
Similarity:135/453 - (29%) Gaps:184/453 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PVEISATLPGQLKFVHVIYRHGDRTPVDPYPT------------------------DPWGDRKF- 93
            ||::.|           :.|||.|     |||                        ...|.|.. 
Human    80 PVQLVA-----------LIRHGTR-----YPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLG 128

  Fly    94 -----WP---TGW--GDLTNLGKQEHYDLGKWLRNRYSNLLPPIYSNEN---IYVQSTDVDRTLM 145
                 ||   ..|  |.|...|:|:.    :.|..|.::|.|.::|.||   :.:.::...|.:.
Human   129 AALADWPLWYADWMDGQLVEKGRQDM----RQLALRLASLFPALFSRENYGRLRLITSSKHRCMD 189

  Fly   146 SAQSNLAGLYEPQGEDIWNTDINWQPIPIHTSPEREDPILAAKAPCPAYDYELASLESSPEF--- 207
            |:.:.|.||              ||    |..|....|             ::|.:|..|..   
Human   190 SSAAFLQGL--------------WQ----HYHPGLPPP-------------DVADMEFGPPTVND 223

  Fly   208 ----------KALTEKHRNLFAYLSEKGGRPVKTFIDAQYLNNTLFIENLYNMTLPKWTKMVYGR 262
                      |.|||..:|..|...      |:.|.....:.|.|                    
Human   224 KLMRFFDHCEKFLTEVEKNATALYH------VEAFKTGPEMQNIL-------------------- 262

  Fly   263 EELTYVSNFAFAISSYTRKLA---RLKAGPLLKDIFQ--RFKEKSSGSLKPDRSMW--VYSAHDT 320
                             :|:|   ::....|..|:.|  .|......::|..:|.|  |:...|.
Human   263 -----------------KKVAATLQVPVNDLNADLIQVAFFTCSFDLAIKGVKSPWCDVFDIDDA 310

  Fly   321 TVASVLNALKLFELHSPPYT-----ACIMME---------LRVDETNTPLVSIFYKNTTAEPLPL 371
            .|...||.||.:......||     :|.:.:         :...:.:.|:.|         |:.|
Human   311 KVLEYLNDLKQYWKRGYGYTINSRSSCTLFQDIFQHLDKAVEQKQRSQPISS---------PVIL 366

  Fly   372 DIPGCGPSCPLTKLMNIYEDVLPVDWERECKLSTMMMTYEEANLGTATGILILIVIALLFASY 434
            .........||..||..::|..|:         |.....::.:....:|:::.....|:|..|
Human   367 QFGHAETLLPLLSLMGYFKDKEPL---------TAYNYKKQMHRKFRSGLIVPYASNLIFVLY 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acph-1NP_733332.1 HP_HAP_like 64..361 CDD:132717 67/368 (18%)
MINPP1NP_004888.2 HP_HAP_like 82..436 CDD:132717 81/451 (18%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 484..487
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.