DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acph-1 and acp6

DIOPT Version :9

Sequence 1:NP_733332.1 Gene:Acph-1 / 48445 FlyBaseID:FBgn0000032 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001072736.1 Gene:acp6 / 780193 XenbaseID:XB-GENE-994568 Length:418 Species:Xenopus tropicalis


Alignment Length:411 Identity:98/411 - (23%)
Similarity:156/411 - (37%) Gaps:93/411 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EGHPVEISATLPGQLKFVHVIYRHGDRTPVDPYP------------------------TDPWGDR 91
            :||..|        ||.|.||||||.|||:.|.|                        ||..|..
 Frog    37 DGHEYE--------LKLVQVIYRHGARTPLKPIPHKEQVEWALAMLAAPDHTQFDYSVTDLVGGP 93

  Fly    92 KFWP----------------TGWGDLTNLGKQEHYDLGKWLRNRY---SNLLPPIYSNENIYVQS 137
            |  |                |..|.||.:|.::.::||..||..|   .:.|.|:|....::|:|
 Frog    94 K--PPSLFEERYRSHTLKGGTFPGQLTTVGMEQMFNLGARLRRNYVEEQHFLSPVYKPSEVFVRS 156

  Fly   138 TDVDRTLMSAQSNLAGLYEPQGE---DIWNTDINWQPI-----PIHTSPEREDPILAAKAPCPAY 194
            |::.|.|.|.:..||||::.|.|   .|...|.|.:.:     ..|...:....:....|..|..
 Frog   157 TNIVRNLESTRCLLAGLFQQQQEGPATIVTADANSEILYPNYHGCHELKQLTSTLTPGAAAQPGM 221

  Fly   195 DYELASLESSPEFKALTEKHRNLFAYLSEKGGRPVKTFIDAQYLNNTLFIENLYNMTLPKWTKMV 259
            ..:|..|.......|..|                    :|...|.:.|..:.::....|...|..
 Frog   222 ADDLNQLRQEMNIDATKE--------------------VDFFLLLDNLLAQEVHGFPCPLKDKSN 266

  Fly   260 YGREELTYVSNFAFAISSYTRKLARLKAGPLLKDIFQRF---KEKSSGSLKPDRSMWVYSAHDTT 321
            ..|.|...::.|.:.|....||:.||..||.|..:.:..   ::.:..:....|.:::|:|||.|
 Frog   267 LQRIEERTINIFCYVIGPSNRKVLRLSVGPFLHTLRRNMLEARDTAGVATAQGRKLYLYAAHDVT 331

  Fly   322 VASVLNALKLFELHSPPYTACIMMELRVDETNTP-LVSIFYKNTTAEPLPLDIPGCGPS-CPLTK 384
            :..:|.||.:|....|||.:.:.:||.....:.. .|.:.|......     :.||... |||.:
 Frog   332 LIPLLMALGIFNKKWPPYASDLTLELYQHRPSKEWFVRLNYNGEEQR-----VRGCQSGLCPLQE 391

  Fly   385 LMNIYED--VLPVDWERECKL 403
            .::...:  :.|.|::..|.:
 Frog   392 FLSALSEFALSPEDYKALCSV 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acph-1NP_733332.1 HP_HAP_like 64..361 CDD:132717 86/351 (25%)
acp6NP_001072736.1 HP_HAP_like 42..373 CDD:132717 87/360 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.