DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acph-1 and Acp6

DIOPT Version :9

Sequence 1:NP_733332.1 Gene:Acph-1 / 48445 FlyBaseID:FBgn0000032 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_062774.2 Gene:Acp6 / 66659 MGIID:1931010 Length:418 Species:Mus musculus


Alignment Length:407 Identity:95/407 - (23%)
Similarity:163/407 - (40%) Gaps:109/407 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QLKFVHVIYRHGDRTPVDPYPTD---PWG-----------------------------DRKFWPT 96
            :||.|.|::|||.|:|:.|.|.:   .|.                             |.::..|
Mouse    42 ELKMVQVVFRHGARSPLKPLPLEEQVEWNPKLLEIPPQTRFDYTVTNLAGGPKPHSHYDTEYRKT 106

  Fly    97 GW------GDLTNLGKQEHYDLGKWLRNRYSNLLP---PIYSNENIYVQSTDVDRTLMSAQSNLA 152
            ..      |.||.:|.|:.:.||:.||..|...:|   |:|:.:.::::||::.|.|.|.:..||
Mouse   107 TLRGGVLAGQLTKVGMQQMFALGEKLRKNYVEDIPFLSPVYNPQEVFIRSTNMFRNLESTRCLLA 171

  Fly   153 GLYEPQ-GEDIWNTDINWQPIPIHTSPEREDPILAAKAPCPAYDYELASLESSPEFKA---LTEK 213
            ||::.| |..:.:||                              |.:|....|.:::   |.||
Mouse   172 GLFQHQKGSAVIHTD------------------------------EASSEVLYPNYQSCWVLKEK 206

  Fly   214 HR-NLFAYLSEKG----GRPVKT--------FIDAQYLNNTLFIENLYNM----TLPKWTKMVYG 261
            .| ...|.:|:.|    ...|||        .:|...|.:.:..|.::::    .|.::.:::  
Mouse   207 TRGRKKAAISQPGISEDLEKVKTGVGINNGDDVDFFVLLDNVAAEQVHSLLNCPALERFAQLI-- 269

  Fly   262 REELTYVSNFAFAISSYTRKLARLKAGPLLKDIFQRFKEKSSGSLKPD--RSMWVYSAHDTTVAS 324
              |...|....:.:....|:..::..||.|..:.....:....:..|.  |.|::|:.||.|:..
Mouse   270 --EQRAVDMALYVVEQEDRESIQMAVGPFLHILEGNLLKTVDPTTAPSKTRKMYLYATHDVTLLP 332

  Fly   325 VLNALKLFELHSPPYTACIMMEL-RVDETNTPLVSIFYKNTTAEPLPLDIPGCGPS-CPLTKLMN 387
            :|.||.:|:...||:...:.||| :..|:....|.:||......|     .||... |||.|.:|
Mouse   333 MLLALGIFDQKWPPFAVDLTMELYQHQESKEWFVQLFYNGKEQVP-----RGCPDKLCPLDKFLN 392

  Fly   388 ---IYEDVLPVDWEREC 401
               :| .|.|..:...|
Mouse   393 TMSVY-SVSPEKYRTLC 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acph-1NP_733332.1 HP_HAP_like 64..361 CDD:132717 81/361 (22%)
Acp6NP_062774.2 HP_HAP_like 42..371 CDD:132717 82/362 (23%)
Substrate binding. /evidence=ECO:0000250 51..161 25/109 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100295
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R958
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.