DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acph-1 and ACP6

DIOPT Version :9

Sequence 1:NP_733332.1 Gene:Acph-1 / 48445 FlyBaseID:FBgn0000032 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_057445.4 Gene:ACP6 / 51205 HGNCID:29609 Length:428 Species:Homo sapiens


Alignment Length:469 Identity:107/469 - (22%)
Similarity:189/469 - (40%) Gaps:118/469 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVTSV-ARKMWNHPSQRWLILICVICLLSFALAN---SLHGYANAEGH-PVEISATLPGQLKFVH 69
            ::|.| :.::|..        :.|:..|::.|..   :|.....|:|. ||:.|..   :||.|.
Human     1 MITGVFSMRLWTP--------VGVLTSLAYCLHQRRVALAELQEADGQCPVDRSLL---KLKMVQ 54

  Fly    70 VIYRHGDRTPVDPYPTD---PW----------------------GDRKFWPTG------------ 97
            |::|||.|:|:.|.|.:   .|                      |.:.:.|..            
Human    55 VVFRHGARSPLKPLPLEEQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQYHETTLKGGM 119

  Fly    98 -WGDLTNLGKQEHYDLGKWLRNRYSNLLP---PIYSNENIYVQSTDVDRTLMSAQSNLAGLYEPQ 158
             .|.||.:|.|:.:.||:.||..|...:|   |.::.:.::::||::.|.|.|.:..||||::.|
Human   120 FAGQLTKVGMQQMFALGERLRKNYVEDIPFLSPTFNPQEVFIRSTNIFRNLESTRCLLAGLFQCQ 184

  Fly   159 GEDIWNTDINWQPIPIHTSPEREDPILAAKAPCPAYD------------YELASLES--SPEFKA 209
            .|.         ||.|||. |.:..:|     .|.|.            .:.|||:.  |.:.|.
Human   185 KEG---------PIIIHTD-EADSEVL-----YPNYQSCWSLRQRTRGRRQTASLQPGISEDLKK 234

  Fly   210 LTEKHRNLFAYLSEKGGRPVKTFIDAQYLNNTLFIENLYNM----TLPKWTKMVYGREELTYVSN 270
            :.::   :....|:|        :|...|.:.:..|..:|:    .|.::.:|:    |...|..
Human   235 VKDR---MGIDSSDK--------VDFFILLDNVAAEQAHNLPSCPMLKRFARMI----EQRAVDT 284

  Fly   271 FAFAISSYTRKLARLKAGPLLKDIFQRFKEKSSGSLKPD--RSMWVYSAHDTTVASVLNALKLFE 333
            ..:.:....|:..::..||.|..:.....:....:..||  |.:::|:|||.|...:|..|.:|:
Human   285 SLYILPKEDRESLQMAVGPFLHILESNLLKAMDSATAPDKIRKLYLYAAHDVTFIPLLMTLGIFD 349

  Fly   334 LHSPPYTACIMMELRVD-ETNTPLVSIFYKNTTAEPLPLDIPGCGPS-CPLTKLMN---IYEDVL 393
            ...||:...:.|||... |:....|.::|......|     .||... |||...:|   :| .:.
Human   350 HKWPPFAVDLTMELYQHLESKEWFVQLYYHGKEQVP-----RGCPDGLCPLDMFLNAMSVY-TLS 408

  Fly   394 PVDWERECKLSTMM 407
            |..:...|..:.:|
Human   409 PEKYHALCSQTQVM 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acph-1NP_733332.1 HP_HAP_like 64..361 CDD:132717 83/358 (23%)
ACP6NP_057445.4 HP_HAP_like 49..379 CDD:132717 83/359 (23%)
Substrate binding. /evidence=ECO:0000250 58..168 24/109 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3720
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1221585at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100295
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R958
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.