DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acph-1 and Pxylp1

DIOPT Version :9

Sequence 1:NP_733332.1 Gene:Acph-1 / 48445 FlyBaseID:FBgn0000032 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001007711.1 Gene:Pxylp1 / 315939 RGDID:1359617 Length:480 Species:Rattus norvegicus


Alignment Length:490 Identity:101/490 - (20%)
Similarity:166/490 - (33%) Gaps:170/490 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RWLILICVICLLSFALANSLHGYANAEGHPVEISATLPG-------------------------- 63
            |:|:|:.:..||:| |:.||..:     |.:.:|.|..|                          
  Rat     6 RFLVLLALAGLLAF-LSLSLQFF-----HLIPVSTTKNGGSSKSRKRIMPDPVTEPPTVDPVYEA 64

  Fly    64 ----------------------QLKFVHVIYRHGDRTPVDPYP---------------------- 84
                                  :|..|||..|||||.|:...|                      
  Rat    65 LLYCNIPSVAEHSMEGHAPHHYKLVSVHVFIRHGDRYPLYAIPKTKRPEIDCTLVASRKPYHPKL 129

  Fly    85 ---------------TDPWGDRKFWPT----GWGDLTNLGKQEHYDLGKWLRNRY---SNLLPPI 127
                           ..|.|....:|.    ..|:||..|..:|...|:.||:.|   ..|||..
  Rat   130 EAFVGHMLKGSGASFESPLGSLPLYPNHPLCEMGELTQTGVVQHLQNGQLLRDIYLRKHKLLPNN 194

  Fly   128 YSNENIYVQSTDVDRTLMSAQSNLAGLYEPQGEDIWNTDINWQPIPIHTSPEREDPILAAKAPCP 192
            :|::.:|:::|...|||   ||.||.||.      :..:.:|:.:.....|..  ...:....||
  Rat   195 WSSDQLYLETTGKSRTL---QSGLALLYG------FLPEFDWKKVYFKHQPSA--LFCSGSCYCP 248

  Fly   193 AYDYELASLESSPEFKALTEKHRNL---FAYLSEKGGRPVKTFIDAQYLNNTLFIENLYNMTLPK 254
            ..:..|.. |...:: .|..|:.:|   :..:::....|.|....|..:::.| ....:|::.|.
  Rat   249 LRNQYLEK-EQRRQY-LLRLKNSDLERTYGEMAKIVDIPTKQLRAANPIDSML-CHFCHNVSFPC 310

  Fly   255 WTKMVYGREELTYVSN---------------FAFAISSYTRKLARLKAGPLLKDIFQRFKEKSSG 304
            ......|.|....:..               |.:::         |.|.|:|.....|.:..:.|
  Rat   311 SRSGCLGMEHFKVIKTHQIEDERERHEKLLYFGYSL---------LGAHPILNQTVNRMQRAALG 366

  Fly   305 SLKPDRSMWVYSAHDTTVASVLNALKLFELHSPPYTACIMMELRVDET----------------- 352
              ..|....:|||||.|::.:|:||.|.|...|.:.|.::.||..|..                 
  Rat   367 --WRDELFTLYSAHDVTLSPILSALGLLEARFPRFAARLVFELWQDRQKPSEHSVRILYNGADVT 429

  Fly   353 -NTPLVSIFYKNTTAEPLPLDIPGCGPSCPLTKLM 386
             :|.....|:|::   |.|:        |||..|:
  Rat   430 FHTSFCHDFHKHS---PKPM--------CPLENLV 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acph-1NP_733332.1 HP_HAP_like 64..361 CDD:132717 80/376 (21%)
Pxylp1NP_001007711.1 HP 87..424 CDD:416258 79/361 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.