DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acph-1 and Acp2

DIOPT Version :9

Sequence 1:NP_733332.1 Gene:Acph-1 / 48445 FlyBaseID:FBgn0000032 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001343996.1 Gene:Acp2 / 11432 MGIID:87882 Length:434 Species:Mus musculus


Alignment Length:379 Identity:134/379 - (35%)
Similarity:212/379 - (55%) Gaps:19/379 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LKFVHVIYRHGDRTPVDPYPTDPWGDRKFWPTGWGDLTNLGKQEHYDLGKWLRNRYSNLLPPIYS 129
            |:||.::||||||:||..||.||:.:.| ||.|:|.||..|..:|::||:.||.||...|...|.
Mouse    33 LRFVTLLYRHGDRSPVKTYPKDPYQEEK-WPQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSYH 96

  Fly   130 NENIYVQSTDVDRTLMSAQSNLAGLYEPQGEDIWNTDINWQPIPIHTSPEREDPILA-AKAPCPA 193
            .:.:||:|||.|||||||::|||||:.|.....:|.:|:|||||:||.|..||.:|. ...|||.
Mouse    97 RQEVYVRSTDFDRTLMSAEANLAGLFPPNEVQHFNPNISWQPIPVHTVPITEDRLLKFPLGPCPR 161

  Fly   194 YDYELASLESSPEFKALTEKHRNLFAYLSEKGGRPVKTFIDAQYLNNTLFIENLYNMTLPKWT-- 256
            |:........:||::..:.::......::.:.|....|......:.:|||.|..:.:.||.|.  
Mouse   162 YEQLQNETRQTPEYQNRSIQNAQFLNMVANETGLTNVTLETIWNVYDTLFCEQTHGLLLPPWASP 226

  Fly   257 KMVYGREELTYVSNFA----FAISSYTRKLARLKAGPLLKDIFQRFKEKSSGSLKPDRSMWVYSA 317
            :.|   :.|:.:.:|:    |.|....:| |||:.|.||..|.:.....::.|..|  .:.||||
Mouse   227 QTV---QRLSQLKDFSFLFLFGIHEQVQK-ARLQGGVLLAQILKNLTLMATTSQFP--KLLVYSA 285

  Fly   318 HDTTVASVLNALKLFELHSPPYTACIMMELRVDETNTPLVSIFYKNTTAE-PLPLDIPGCGPSCP 381
            ||||:.::..||.::.....||.:|.:.||..::.....|.::::|.:.: |.||.:|||...||
Mouse   286 HDTTLVALQMALNVYNGKQAPYASCHIFELYQEDNGNFSVEMYFRNDSKKAPWPLILPGCPHRCP 350

  Fly   382 LTKLMNIYEDVLPVDWERECKLSTMMMTYEE----ANLGTATGILILIVIALLF 431
            |...:.:.|.|:|.||::||:|:......|.    |..|:...:||::::.:||
Mouse   351 LQDFLRLTEPVIPKDWQKECQLANDTADTEVIVALAVCGSILFLLIVLLLTILF 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acph-1NP_733332.1 HP_HAP_like 64..361 CDD:132717 109/302 (36%)
Acp2NP_001343996.1 HP_HAP_like 33..330 CDD:132717 109/303 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846117
Domainoid 1 1.000 160 1.000 Domainoid score I4032
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1217
Inparanoid 1 1.050 233 1.000 Inparanoid score I3408
Isobase 1 0.950 - 0 Normalized mean entropy S5170
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002540
OrthoInspector 1 1.000 - - mtm8763
orthoMCL 1 0.900 - - OOG6_100295
Panther 1 1.100 - - LDO PTHR11567
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R958
SonicParanoid 1 1.000 - - X1300
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.