DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kebab and Ndc80

DIOPT Version :9

Sequence 1:NP_001259900.1 Gene:Kebab / 48440 FlyBaseID:FBgn0028952 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_572902.1 Gene:Ndc80 / 32316 FlyBaseID:FBgn0030500 Length:675 Species:Drosophila melanogaster


Alignment Length:582 Identity:117/582 - (20%)
Similarity:193/582 - (33%) Gaps:240/582 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 KTPEFRSRTNKTIPASEPRPRRAKELLEDLRSKHQGTPATKIPSQRNPKENQELSKSHTCIPSSE 174
            :|.|||....:....::.|..||.:     ||....||::...:.|.|.            .|..
  Fly     8 RTSEFRGDVLEERGTADKRQTRATK-----RSAATHTPSSSQAAPRRPS------------ASRL 55

  Fly   175 PQPIRPKLILERERQESITNRLASTSIDRLKTKPPRSSFTSSRLLVPQMGFSYPKDPKRLHESDK 239
            |||:.    |||:|                               ..|||.:    |||.|.   
  Fly    56 PQPLN----LERDR-------------------------------ASQMGVT----PKRGHR--- 78

  Fly   240 GIKLTTSKRKLDFKTELGTDWLRRELEKIGKEWRKKTDYQLRQLISGF----------------- 287
             ...:|::|.:...::              |:|..:...|:.:.:.|.                 
  Fly    79 -FVPSTAERAIAPHSD--------------KKWVAERAQQILEYLHGIQNSEAPTGLIADLFSRP 128

  Fly   288 -------VKQLVRLLPFNGITFSHLSRD------CYVQQMVEALQQLQYTKKVNKSWLQTPNSTQ 339
                   :||.|.:|.|   .|.|:.|:      .:|:.:..|:|:|||..:||||||.:|.:..
  Fly   129 GGLRHMTIKQFVSILNF---MFHHIWRNRVTVGQNHVEDITSAMQKLQYPYQVNKSWLVSPTTQH 190

  Fly   340 AIAHVLELLNFLLDVL------------------------------------------------- 355
            :..||:.||:||:|.|                                                 
  Fly   191 SFGHVIVLLDFLMDFLPPLPSSDVVEEEFPFMETMEQPSSYLNSMHCESTTIMSTTQAHAIQLDE 255

  Fly   356 -----------------------EHRKGEG---------MCALPVVSEKQRIEQLASASGTSYDV 388
                                   |..|.:.         .|.||   :::.::||.....|.  :
  Fly   256 DVNGLLFEEASKCIALWDQELTNEEAKLQAETRDQVISKKCDLP---DRKALDQLIGDLKTK--L 315

  Fly   389 MSLQQKF----ENIKIEK-ERLNNYQESLMPESPVSKD------------MDKVTERDGN----- 431
            ..|:.|.    |:.|:.| |||....:.|..:...|::            ..:|.|:..|     
  Fly   316 QQLENKLHDPSEDNKLNKLERLTKEHDQLAQQLAASEEELIKKLKLYEQLSAQVEEKQSNLRQQM 380

  Fly   432 ------QDFVRLLDFQKETLHELQLQ-----------RLRLQEFSELVSLAKIKLKRCCKANKQC 479
                  :..|....|..:.|.|||::           ..:::|.|||....::.|.|..:.....
  Fly   381 KYEKRLEQAVNRQKFSAQQLKELQMKCDDMENYSKAYERQVKEVSELELHQQVMLSRAKQKQLDS 445

  Fly   480 IEAFNDQIQDLA-DCVV--LRNRNIGLLTQLHLNDNPKEEELHERMKQLQRLYEDNYSNLLQ 538
            :|.||..::.|: |.|:  |....||..:.|.|..||.:|::.||::.|:.|     ..|||
  Fly   446 VEVFNSHVRHLSMDPVICGLIKSGIGQQSDLTLPLNPNQEDISERVQCLELL-----GKLLQ 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KebabNP_001259900.1 AvrE 77..>308 CDD:288561 41/221 (19%)
Ndc80NP_572902.1 Ndc80_HEC 63..204 CDD:281754 42/196 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019602
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.