DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and YNR064C

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_014462.1 Gene:YNR064C / 855801 SGDID:S000005347 Length:290 Species:Saccharomyces cerevisiae


Alignment Length:296 Identity:61/296 - (20%)
Similarity:98/296 - (33%) Gaps:73/296 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 WY------GNRQVRPILALHGWLDNLGTWDKLLPLLPKHLGVLCIDLPGHGYSSKLPEGIAYHFV 97
            ||      ||   ..||.|||:..:...:..|:|||.....::..||||.|: ::.||...:.| 
Yeast    20 WYREAGAAGN---PTILLLHGFPTSSNMFRNLIPLLAGQFHIIAPDLPGFGF-TETPENYKFSF- 79

  Fly    98 DYLC-VILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLVS-----------------I 144
            |.|| .|..:::....:|.::......:.:.|..|..:|.|...:|:                 :
Yeast    80 DSLCESIGYLLDTLSIEKFAMYIFDYGSPVGFRLALKFPSRITGIVTQNGNAYEEGLDDRFWGPL 144

  Fly   145 DIVKTRYRKPP----SQIDYLRKNIEGYIVEDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVEL 205
            ......|:..|    |.|.||...........:.....:..:|.|||   ::..|.:.|.     
Yeast   145 KEYWKSYQSDPVFVKSLIPYLEDPANVICQYHDGVPAIESVDPAAYT---LDIALIQRTG----- 201

  Fly   206 ENCRHILERNISRSTKFPAKFFFSRDGRCKYYTEFHTSPPFAAELARTIKNVPYCVIKGSESNYI 270
                         .|....:.||......|.|..|.       :..|..| :|..|..|:.....
Yeast   202 -------------QTDIQLRLFFDYQNNIKLYPAFQ-------KFLRDSK-IPVLVAWGANDTIF 245

  Fly   271 DEQSDEV-------IGILRENNPHFELHEVQGTHHV 299
            .....|.       :.::..:..||.|.    ||.|
Yeast   246 SVAGAEAYRKDVDNLKVVYYDTGHFALE----THVV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 57/283 (20%)
YNR064CNP_014462.1 Abhydrolase_1 30..275 CDD:395444 54/279 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341719
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.