DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and CLD1

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_011625.3 Gene:CLD1 / 853007 SGDID:S000003342 Length:445 Species:Saccharomyces cerevisiae


Alignment Length:327 Identity:62/327 - (18%)
Similarity:117/327 - (35%) Gaps:104/327 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VRPILALHGWLDNLGTWDKL---LPLLPKHLGVLCIDLPGHGYSSK------LPEGIAYHFVDYL 100
            ::.::.:||:...||.:.|.   :|||.....:..|||||:|:||:      .|....:...|:.
Yeast   140 LKHLVFIHGYGAGLGFFIKNFEDIPLLDNEWCIHAIDLPGYGFSSRPKFPFEYPRDNIHSVQDWF 204

  Fly   101 CVILRVMEEYRW----------QKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDIVKTRYRKPP 155
            ...:     :.|          :|..:||||:.:.|..::..                 :|::.|
Yeast   205 HERI-----HTWFSKRNLLNRPEKNIVMAHSLGSYLMALYLQ-----------------KYKESP 247

  Fly   156 SQIDYLRKNIEGYIVEDERFANS----KRQEPPAYTYT-----------------EMEQVLYKGT 199
            |....:..:..|....|  |.|:    ::.:||.:.|.                 ::...:..|.
Yeast   248 SFKKLILCSPAGVSYRD--FNNTASEVEKWKPPPWWYVKLWDRNISPFTLVRNFRQLGSKITSGW 310

  Fly   200 DYSVELENCRHILERNISRSTKFPAKF-----FFSRDGRCKYYTEFHT----SPPFAAELARTIK 255
            .|    ...:|||..:..:|.:|.|..     .|::.|..:|...|..    .|..:.| .:...
Yeast   311 SY----RRFKHILNGDPEQSKRFEALHRYAYAIFNKRGSGEYLLSFALKCGGEPRLSLE-QQLFD 370

  Fly   256 NVPYCVIKGSESNYI----DEQSDEVIGILRENN---------------PHFELHEVQGTHHVHL 301
            .....::|.|..:::    |:...:|.|.||.:.               ||       ..||::|
Yeast   371 GKKSDILKNSNCDWLWLYGDDDWMDVNGGLRVSRFLKEKLKQKSNVIIVPH-------SGHHLYL 428

  Fly   302 NN 303
            :|
Yeast   429 DN 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 62/326 (19%)
CLD1NP_011625.3 PLN02894 103..439 CDD:215484 62/327 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341705
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.