DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and AT1G72620

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_177406.2 Gene:AT1G72620 / 843594 AraportID:AT1G72620 Length:335 Species:Arabidopsis thaliana


Alignment Length:213 Identity:43/213 - (20%)
Similarity:81/213 - (38%) Gaps:58/213 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GKWYGNRQVRPI----LALHGWLDNLGTWD----------------KLLPLLPKHLGVLCIDLPG 81
            ||.|.....|.|    .::.|.|..||..|                ::..:.|:.:..|.|...|
plant   121 GKSYSRNTDRTIEFQARSIVGGLKRLGCGDGDLSVYSISYGGFVAYRIAKIWPEMIEKLVIVSSG 185

  Fly    82 HGYS--SKLPEGIAYHFVDYLCVI-------LRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHR 137
            .|::  .|:.| :..|..|...::       ||:          |:..||:..:.|:  ...|  
plant   186 VGFTQQQKMTE-MKKHGGDVSEILVPSNPRDLRL----------LVKVSMNTGIRFL--DWVP-- 235

  Fly   138 TDMLVSIDIVKTRYRKPPSQIDYLRKNIEGYIVEDERFANSKRQEPPAYTYTEMEQVLYKGTDYS 202
             |.::| ..:...|.....::..|.||    ::|.|       :||..::.::...:::...|..
plant   236 -DFILS-QFIAVMYETNRQELVDLAKN----LLERE-------EEPELFSISQRTLIVWGDKDNV 287

  Fly   203 VELENCRHILERNISRST 220
            ..||:.|. |:|::..|:
plant   288 FPLEHGRR-LQRHLPNSS 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 40/204 (20%)
AT1G72620NP_177406.2 MhpC 59..334 CDD:223669 43/213 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.