DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and AT1G17430

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_564022.1 Gene:AT1G17430 / 838315 AraportID:AT1G17430 Length:332 Species:Arabidopsis thaliana


Alignment Length:114 Identity:26/114 - (22%)
Similarity:37/114 - (32%) Gaps:49/114 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KEPMDVR----IDMPWGYVVGKWY--------------GNRQ----------------VRPILA- 50
            |.|||:|    |.|..|.....|.              .|||                ..|::: 
plant   209 KTPMDLRLLIKISMNTGLTFVDWVPDFFLSQFIAVMYEKNRQELLELAKNLLEREEEPELPVISQ 273

  Fly    51 --LHGWLDNLGTWDKLLPL-----LPKHLGVLCIDL---PGHGYSSKLP 89
              |..|    |..||:.||     |.:||....:::   .||..:.:.|
plant   274 KTLIVW----GDKDKVFPLEHAYRLQRHLQSSRLEIIKETGHAVNIEAP 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 14/55 (25%)
AT1G17430NP_564022.1 MhpC 78..328 CDD:223669 26/114 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.