DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and AT1G13820

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_172837.1 Gene:AT1G13820 / 837943 AraportID:AT1G13820 Length:339 Species:Arabidopsis thaliana


Alignment Length:112 Identity:28/112 - (25%)
Similarity:45/112 - (40%) Gaps:20/112 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QVRPILALHGWLDNLGTWDKLLPLLPK-HLGVLCIDLPGHGYS--SKLPEGIAYHFVDYLCVILR 105
            :..|::.|||:..:...|....|||.: .|.....|:.|.|:|  .|||.          |.:..
plant    81 ETTPVVLLHGFDSSCLEWRYTYPLLEEAGLETWAFDILGWGFSDLDKLPP----------CDVAS 135

  Fly   106 VMEEYR--WQK-----VSLMAHSMSAMLCFVFASLYPHRTDMLVSID 145
            ..|.:.  |:.     |.|:..|:.|.:....|..:|...:.||.:|
plant   136 KREHFYKFWKSHIKRPVVLVGPSLGAAVAIDIAVNHPEAVESLVLMD 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 28/110 (25%)
AT1G13820NP_172837.1 MhpC 82..327 CDD:223669 28/111 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.