DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and AT5G39220

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_198738.2 Gene:AT5G39220 / 833918 AraportID:AT5G39220 Length:330 Species:Arabidopsis thaliana


Alignment Length:159 Identity:39/159 - (24%)
Similarity:66/159 - (41%) Gaps:30/159 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VRIDMPWGYVVGKWYGN------------RQVRPILALHGWLDNLGTWDKLLPLLPKH-LGVLCI 77
            |||.:|  ..:|.:.|:            ....|::.||.:..:...|.:..|||.:. |....|
plant    52 VRIPVP--LQMGNFRGSVMSSCIKPLVQLHDKSPVVLLHCFDSSCLEWRRTYPLLEQACLETWAI 114

  Fly    78 DLPGHGYS--SKLPEGIA----YHFVDYLCVILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPH 136
            |:.|.|:|  .|||...|    :|       :..:.:.|..:.:.|:..|:.|.:...|.:.||.
plant   115 DVLGWGFSDLEKLPPCDAASKRHH-------LFELWKTYIKRPMILVGPSLGATVAVDFTATYPE 172

  Fly   137 RTDMLVSIDIVKTRYRKPPSQIDYLRKNI 165
            ..|.||.|:  ...|.:...::..|.|:|
plant   173 AVDKLVLIN--ANAYSEGTGRLKELPKSI 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 33/127 (26%)
AT5G39220NP_198738.2 MhpC 79..327 CDD:223669 33/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.