DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and AT5G09430

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_196505.2 Gene:AT5G09430 / 830802 AraportID:AT5G09430 Length:311 Species:Arabidopsis thaliana


Alignment Length:247 Identity:47/247 - (19%)
Similarity:83/247 - (33%) Gaps:69/247 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NRQVRPILALHGWLDN-LGTWDKLLPLLPKHLGVLCIDLPGHGYSSKLPEGIAYHFVDYLCVILR 105
            ||....:|.|||:..| :..:.:.|........|...||...|.||.........| ...| ::|
plant    57 NRSKPNLLLLHGFGANAMWQYGEHLRAFTGRFNVYVPDLLFFGLSSTSEPNRTESF-QARC-LMR 119

  Fly   106 VMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDIVKTRYRKPPSQIDYLRKNIEGYIV 170
            :||.:..|:::::..|....:.:..|:.:|...:.||..                    ..|..:
plant   120 LMEAHGVQRMNIVGISYGGFVGYSLAAQFPENVEKLVLC--------------------CAGVCL 164

  Fly   171 EDERFANSKRQEPPAYTYTEMEQVLYKGTDYSVELENCRHILERNISRSTKFPAKFFFSRDGRCK 235
            |::                :||..|:|..:    ||....||........|...:|.|       
plant   165 EEK----------------DMEDGLFKVPN----LEEATGILIPQTPEKLKELIRFSF------- 202

  Fly   236 YYTEFHTSPPFAAELARTIKNVP----YCVIKGSESNYIDEQSDEVIGILRE 283
                           .:.||.||    :..|....:.:::|:.|.:..||::
plant   203 ---------------VKPIKGVPSFFLWDFIDVMCTEFVEEKRDLIKSILKD 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 45/243 (19%)
AT5G09430NP_196505.2 MhpC 60..307 CDD:223669 45/244 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.