DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and AT4G39955

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_568075.1 Gene:AT4G39955 / 830156 AraportID:AT4G39955 Length:328 Species:Arabidopsis thaliana


Alignment Length:224 Identity:46/224 - (20%)
Similarity:79/224 - (35%) Gaps:70/224 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ILALHGWLDN-LGTWDKLLPLLPKHLGVLCIDLP--GHGYSSKLPEGIAYHFVDYLCVILRVMEE 109
            :|.|||...| :..||:.:........|...||.  |..|:::.....::...   || ::.|:.
plant    52 LLLLHGIGANAMWQWDRFIDRFIPRFNVYVPDLIFFGDSYTTRPDRSESFQAT---CV-MKAMDA 112

  Fly   110 YRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSI------------------------------ 144
            |..:.:::...|....:.:..|:.:..|.|.:|.|                              
plant   113 YGVRTMTVAGLSYGGFVAYSLAAQFKERVDRVVLICAGVALEEKDSEDGMFKVKSPEEAAAVLFP 177

  Fly   145 -------DIVKTRYRKPPSQI--------------DYL--RKNIEGYIVEDERFAN-SKRQEPPA 185
                   .:::..:.|||..|              |||  ||.:...:.:..|||| .|..:|..
plant   178 QSPSMLRRLLQLSFYKPPIWIPSCFAMDYIHVMCKDYLQERKELVEALHKGRRFANLPKITQPTL 242

  Fly   186 YTYTEMEQVLYKGTDYSVELENCRHILER 214
            ..:.|.:||      :.|||   .|.|:|
plant   243 MIWGEEDQV------FPVEL---AHRLKR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 46/224 (21%)
AT4G39955NP_568075.1 MhpC 47..297 CDD:223669 46/224 (21%)
Abhydrolase_5 51..280 CDD:289465 46/224 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.