DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and AT4G02340

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_567228.1 Gene:AT4G02340 / 828063 AraportID:AT4G02340 Length:324 Species:Arabidopsis thaliana


Alignment Length:329 Identity:70/329 - (21%)
Similarity:111/329 - (33%) Gaps:74/329 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ILALHGWLDNLGTW-DKLLPLLPKHLGVLCIDLPGHGYSSKLPEGIAYHFVDYLCVILRVMEEYR 111
            ||.:||:.|...:| .:|:.........:..||.|:|.|...|...:|..:..:..::.:::...
plant    27 ILFVHGFPDLWYSWRHQLVSFAALGYRAIAPDLRGYGDSDAPPSRESYTILHIVGDLVGLLDSLG 91

  Fly   112 WQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDIV---KTRYRKPPSQI------DY--LRKNI 165
            ..:|.|:.|...|::.:....:.|.|.:.||:..:|   :....||....      ||  .|...
plant    92 VDRVFLVGHDWGAIVAWWLCMIRPDRVNALVNTSVVFNPRNPSVKPVDAFRALFGDDYYICRFQE 156

  Fly   166 EGYIVED----------ERFANSKRQEPPAYTYTEMEQVLYKGTDYSVELENCRHILERNIS-RS 219
            .|.|.||          .||..|:...||...    :.|.::|......|.  ..:.|:::. ..
plant   157 PGEIEEDFAQVDTKKLITRFFTSRNPRPPCIP----KSVGFRGLPDPPSLP--AWLTEQDVRFYG 215

  Fly   220 TKFPAKFFFSRDGRCKYYTEFHTSPPFAAELARTIKNVPYCVIKG---------SESNYIDEQSD 275
            .||..|.|   .|...||...:.|....|........||...|.|         ....||.|   
plant   216 DKFSQKGF---TGGLNYYRALNLSWELTAPWTGLQIKVPVKFIVGDLDITYNIPGTKEYIHE--- 274

  Fly   276 EVIGILRENNPHF-ELHEVQGTHHVHLNNAQGVAAVINPFILHHRPPHLENWTVDGTDETLPEVV 339
               |.|:::.|.. |:..::|..|                .||...|          ||....:.
plant   275 ---GGLKKHVPFLQEVVVMEGVGH----------------FLHQEKP----------DEVTDHIY 310

  Fly   340 KEFK 343
            ..||
plant   311 GFFK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 64/302 (21%)
AT4G02340NP_567228.1 MhpC 5..315 CDD:223669 70/329 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2617
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.