DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and AT4G15960

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_193331.6 Gene:AT4G15960 / 827279 AraportID:AT4G15960 Length:375 Species:Arabidopsis thaliana


Alignment Length:369 Identity:72/369 - (19%)
Similarity:118/369 - (31%) Gaps:129/369 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QNKEPMDVRID-------------MPWGYVVGKWYGNRQVRPILALHGWLDNLGTWDKLLPLLPK 70
            |.|.|...|:|             |......|...|...:  ||.|||:.:...||...:..| .
plant    42 QTKRPEKSRLDGVEHKTLKVNGINMHVAEKPGSGSGEDPI--ILFLHGFPELWYTWRHQMVAL-S 103

  Fly    71 HLGVLCI--DLPGHGYSSKLPEGI---AYHFVDYLCVILRVMEEYRWQKVSLMAHSMSAMLCFVF 130
            .||...|  ||.|:| .::.||.:   .|..||...|.|........:.||::.|...||:.:..
plant   104 SLGYRTIAPDLRGYG-DTEAPEKVEDYTYLNVDGDVVALIDAVTGGDKAVSVVGHDWGAMIAWQL 167

  Fly   131 ASLYPHRTDMLVSIDI---------------------------------VKTRYRKPPSQ---ID 159
            ....|.:...||::.:                                 ::|.::|..::   .:
plant   168 CQYRPEKVKALVNMSVLFSPRNPVRVPVPTLRHVFGDDYYVCRFQKAGEIETEFKKLGTENVLKE 232

  Fly   160 YLRKNIEG--YIVEDERFANSKR----------QEPPAYTYTEMEQVLYKG-TDYSVELENCRHI 211
            :|.....|  .:.:|:.|..|:.          ||...|..|:.|...:.| .:|          
plant   233 FLTYKTPGPLNLPKDKYFKRSENAASALPLWLTQEDLDYYVTKYENKGFTGPINY---------- 287

  Fly   212 LERNISRS-----------TKFPAKFF-------FSRDGRCKYYT--EFHTSPPFAAELARTIKN 256
             .|||.|:           .:.|.||.       ::..|..:|..  .|....|...|..     
plant   288 -YRNIDRNWELTAPWTGAKIRVPVKFIIGDQDLTYNFPGAKEYINGGGFKRDVPLLDETV----- 346

  Fly   257 VPYCVIKGSESNYIDEQSDEVIGILRENNPHFELHEVQGTHHVH 300
                |:||. .:::.|::.:||                 ..|:|
plant   347 ----VLKGL-GHFLHEENPDVI-----------------NQHIH 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 64/329 (19%)
AT4G15960NP_193331.6 MhpC 55..371 CDD:223669 67/356 (19%)
Abhydrolase 64..372 CDD:304388 67/347 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2617
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.