DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and AT3G51000

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_190669.1 Gene:AT3G51000 / 824264 AraportID:AT3G51000 Length:323 Species:Arabidopsis thaliana


Alignment Length:318 Identity:72/318 - (22%)
Similarity:121/318 - (38%) Gaps:51/318 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WGYVVGKWYGNRQVRPILALHGWLDNLGTWDKLLPLLPKH-LGVLCIDLPGHGYSSKLPEGIAYH 95
            |..|..|  |:.:...:|.|||:.:...:|...:..|..| ..|:..||.|:|.|..||...:|.
plant    16 WLNVAEK--GDEEGPLVLLLHGFPETWYSWRHQIDFLSSHGYHVVAPDLRGYGDSDSLPSHESYT 78

  Fly    96 FVDYLCVILRVMEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDIVKTRY--RKP---P 155
            ....:..::.:::.|...:..:..|...|::.:......|.|....:|:.:   .|  |.|   |
plant    79 VSHLVADVIGLLDHYGTTQAFVAGHDWGAIIGWCLCLFRPDRVKGFISLSV---PYFPRDPKLKP 140

  Fly   156 SQIDYLRKNIEG-YIVEDERFANSKRQEPPAYTYTEMEQVLYK-----GTDYSV---ELENCRH- 210
            |  |:.:...:| ||.:   |....|.| .|:...:...|:.|     .|||.|   :.|...| 
plant   141 S--DFFKIFGDGLYITQ---FQKPGRAE-AAFAKHDCLSVMKKFLLITRTDYLVAPPDTEIIDHL 199

  Fly   211 ---------ILERNIS-RSTKFPAKFFFSRDGRCKYYTEFHTSPPFAAELARTIKNVPYCVIKGS 265
                     |.|..|. .:.||....|   .|...||.....:....|....:...||...|.|.
plant   200 EIPSTIPDWITEEEIQVYAEKFQRSGF---TGPLNYYRSMDMNWEILAPWQDSKIVVPTKFIAGD 261

  Fly   266 E-------SNYIDEQSDEVIGILRENNPHFELHEVQGTHH-VHLNNAQGVAAVINPFI 315
            :       :..::....||..|:   .|:.|:..::|.|| :....::.|:..|..|:
plant   262 KDIGYEGPNGTMEYVKGEVFKIV---VPNLEIVVIEGGHHFIQQEKSEQVSQEILSFL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 68/304 (22%)
AT3G51000NP_190669.1 MhpC 10..319 CDD:223669 72/318 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2617
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.