DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and AT3G10840

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_187695.3 Gene:AT3G10840 / 820253 AraportID:AT3G10840 Length:466 Species:Arabidopsis thaliana


Alignment Length:164 Identity:34/164 - (20%)
Similarity:60/164 - (36%) Gaps:58/164 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PILALHGWLDNLGTWDKLLPLLPKHLG--VLCIDLPGHGYSSKL---------------PEGIAY 94
            |::.|||:..::.:|::::..|.:.:.  ||..|.|..|.:|::               |..:.|
plant   132 PMILLHGFGASVFSWNRVMKPLARLVSSKVLAFDRPAFGLTSRIFHPFSGATNDAKPLNPYSMVY 196

  Fly    95 ------HFVDYLCVILRVMEEYRWQKVSLMAHSMSAMLCFVFASLY---PHRTDMLVSI------ 144
                  :|:|.|..          .|..|:.||..   |.|....|   |.|...|:.:      
plant   197 SVLTTLYFIDVLAA----------DKAILVGHSAG---CPVALDAYFEAPERVAALILVAPAIFA 248

  Fly   145 -------DIVKTRYRKPPSQIDYLRKNIEGYIVE 171
                   |..:.|.::.|:      .|..|.:||
plant   249 PRPVATTDAGENRDKEAPT------SNFLGTLVE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 34/164 (21%)
AT3G10840NP_187695.3 MhpC 111..445 CDD:223669 34/164 (21%)
Abhydrolase_5 132..292 CDD:289465 34/164 (21%)
Abhydrolase_5 <379..427 CDD:289465
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1285824at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.