DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and AT3G10840

DIOPT Version :10

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_187695.3 Gene:AT3G10840 / 820253 AraportID:AT3G10840 Length:466 Species:Arabidopsis thaliana


Alignment Length:164 Identity:34/164 - (20%)
Similarity:60/164 - (36%) Gaps:58/164 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PILALHGWLDNLGTWDKLLPLLPKHLG--VLCIDLPGHGYSSKL---------------PEGIAY 94
            |::.|||:..::.:|::::..|.:.:.  ||..|.|..|.:|::               |..:.|
plant   132 PMILLHGFGASVFSWNRVMKPLARLVSSKVLAFDRPAFGLTSRIFHPFSGATNDAKPLNPYSMVY 196

  Fly    95 ------HFVDYLCVILRVMEEYRWQKVSLMAHSMSAMLCFVFASLY---PHRTDMLVSI------ 144
                  :|:|.|..          .|..|:.||..   |.|....|   |.|...|:.:      
plant   197 SVLTTLYFIDVLAA----------DKAILVGHSAG---CPVALDAYFEAPERVAALILVAPAIFA 248

  Fly   145 -------DIVKTRYRKPPSQIDYLRKNIEGYIVE 171
                   |..:.|.::.|:      .|..|.:||
plant   249 PRPVATTDAGENRDKEAPT------SNFLGTLVE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MenH 46..>165 CDD:440361 30/156 (19%)
Abhydrolase_6 48..310 CDD:463673 33/163 (20%)
AT3G10840NP_187695.3 MenH 115..446 CDD:440361 34/164 (21%)

Return to query results.
Submit another query.