DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5707 and AT2G26750

DIOPT Version :9

Sequence 1:NP_001246563.1 Gene:CG5707 / 48422 FlyBaseID:FBgn0026593 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_180243.1 Gene:AT2G26750 / 817216 AraportID:AT2G26750 Length:320 Species:Arabidopsis thaliana


Alignment Length:295 Identity:59/295 - (20%)
Similarity:109/295 - (36%) Gaps:68/295 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ILALHGWLDNLGTW-DKLLPLLPKHLGVLCIDLPGHGYSSKLPEGIA----YHFV-DYLCVILRV 106
            :|.|||:.:...:| .::..|..:....:..||.|:| .|..|..|:    ::.| |.:.||..:
plant    26 VLLLHGFPELWYSWRHQISGLAARGYRAVAPDLRGYG-DSDAPAEISSFTCFNIVGDLVAVISTL 89

  Fly   107 MEEYRWQKVSLMAHSMSAMLCFVFASLYPHRTDMLVSIDIVKTRYRKPPS--QIDYLRK------ 163
            ::|.:  ||.::.|...|::.:......|.:...||::.:..:.:...||  .:|.:|.      
plant    90 IKEDK--KVFVVGHDWGALIAWYLCLFRPDKVKALVNLSVPLSFWPTDPSVKPVDRMRAVYGNDY 152

  Fly   164 ---------NIEGYIVE-----------------------DERFANSKRQEPPAYTYTEMEQVLY 196
                     :||..|.|                       |:.|..||.:..|..::...|.|.|
plant   153 YVCRFQEVGDIEAEIAEVGTERVMKRLLTYRTPGPLIIPKDKSFWGSKGETIPLPSWLTEEDVAY 217

  Fly   197 -------KG----TDYSVELENCRHILERNISRSTKFPAKFFFSRDGRCKYY----TEFHTSPPF 246
                   ||    .:|.........:|...:....:.|.||... :....||    .|:...|.|
plant   218 FVSKFKEKGFCGPVNYYRNFNRNNELLGPWVGSKIQVPTKFVIG-ELDLVYYMPGVKEYIHGPQF 281

  Fly   247 AAELARTIKNVPYCVIKGSESNYIDEQSDEVIGIL 281
            ..::....:.|   |::|.......|:..|::.|:
plant   282 KEDVPLIEEPV---VMEGVAHFLNQEKPQEILQII 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5707NP_001246563.1 MhpC 46..318 CDD:223669 59/295 (20%)
AT2G26750NP_180243.1 MhpC 2..317 CDD:223669 59/295 (20%)
Abhydrolase 8..>123 CDD:304388 23/99 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2617
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.